KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510914
Entry
107510914         CDS       T06036                                 

Gene name
PLA2G4E
Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107510914 (PLA2G4E)
   00565 Ether lipid metabolism
    107510914 (PLA2G4E)
   00590 Arachidonic acid metabolism
    107510914 (PLA2G4E)
   00591 Linoleic acid metabolism
    107510914 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    107510914 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510914 (PLA2G4E)
   04014 Ras signaling pathway
    107510914 (PLA2G4E)
   04370 VEGF signaling pathway
    107510914 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    107510914 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107510914 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107510914 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    107510914 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    107510914 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107510914 (PLA2G4E)
   04913 Ovarian steroidogenesis
    107510914 (PLA2G4E)
   04921 Oxytocin signaling pathway
    107510914 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510914 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    107510914 (PLA2G4E)
   04726 Serotonergic synapse
    107510914 (PLA2G4E)
   04730 Long-term depression
    107510914 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510914 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107510914 (PLA2G4E)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107510914 (PLA2G4E)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107510914
NCBI-ProteinID: XP_016000354
LinkDB
Position
Unknown
AA seq 887 aa
MLRSSPSSSQPVWSPGEMDVAGMTLQAPEGHAGLGADVFAPQSLQGDGEDSRSGRNVSEF
EHAQDLEASNHLPLLPTAPWGSQKELSPCHLLTVTVIRMKNVRQADRVTQTDCYVSLWLP
TASRERVRTRTISNCPNPEWNESFNFQIQRQVKNVLELSICDEDAVIPDDHLLTVLYDLT
KLGCRRKTHVKFPLNPEAMEELEVEFLLEESPCPPETLITNGVLVARQVSSLEVHAESRR
QRKRGKRRDLLVTVTESFEHTQHISQHLEPSCQKPACFHYPKYFQSQMHVDLPRSQWSCG
LCFSGVHKKSSPVCQPLDCLSDSQTVTLPAGENCELHVKSTPCPKTLDVRLGYSLCQEEL
EFLQKRKVVVAEALKQVLQLEEDLQMDEVPLIAIMSTGGGTRSMTAMYGHLLGLQKLNLL
NCASYITGISGATWTMANLYRDPDWSSKNLESAILEARRHVVKDKMPILYPDQLFRYQEE
LQQRSKEGYKVNFTDFWGLLIEACLGDERNECKLSEQRAALSQGQNPLPIYLTINVKDDV
SNQDFREWCEFSPYEVGMQKYGAFVPTELFGSEFFMGRLMKRIPESRMCYMLGLWSSIFS
VNLLDVWNFCSTSDEFFHRWTREKVQDIEDEPLLPEIPICDANVLDTSVVVPASWLSNTF
RHILTHRSFVSEFHNFLLGLQLHTNYLQNGQFSMWKDTVLDGFPNQLTGSVNHLSLLDTA
FFVNSSYPPLLRPERKPDLIIHLNYCAGSQTKPMKQTCEYCTEKNIPFPKYDLQEEENDN
LKECYLLENSQEPDAPIVLFFPLINDTFQKYKAPGVERSPEEMEKGQVDIYGPKTPYSTK
ELTYTEAAFDKMVNLCEYNILNNKDQLLQALRMAVEKKKLWKSRCPS
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgctaagaagcagtcccagctcctcacaacctgtctggagccccggagagatggatgtg
gctgggatgacgctccaggccccggaaggccatgctggcctgggagctgatgtgtttgcc
ccacagagcctacaaggggatggagaagatagcagatcaggaagaaatgtcagtgagttt
gagcacgcacaggacctggaagcttccaatcacctacctctccttcccacggccccgtgg
ggctctcagaaggagctatctccatgccacttgctaacagtgacggtcatcaggatgaaa
aatgtccggcaggctgatagggtgacccagacagactgctatgtgagcctctggctgcct
actgcctctcgcgagagggtgaggacgaggaccatctccaactgcccaaacccagaatgg
aatgaaagcttcaacttccagatccagaggcaagtgaagaacgtgctagagcttagcatc
tgtgatgaagacgcagtaataccagatgaccatcttttgacagttctctatgacctaacc
aagctcggctgccggaggaaaacccatgtgaagttcccacttaacccagaggccatggag
gagctggaggtagagtttctgctggaggaaagtccctgtccacctgagaccctcatcacc
aatggcgtgctggtggctcgacaagtctcttccctagaggttcatgcagaatccagaagg
cagaggaagagagggaaacggagggacctcctagtgacagtgacagagtccttcgagcac
acgcagcacatctcccaacacctggagcccagctgccaaaaacctgcctgctttcactac
cccaagtacttccagtcccagatgcatgtggacctgccccggagccagtggagctgtggg
ctttgcttctctggtgtgcacaagaagagcagccctgtctgccagcccctcgattgcctc
tcggacagccagacggtgaccctgcctgcgggagagaactgtgaattacacgtgaagtct
acaccctgccccaagacactggatgtgcgactgggctacagcctgtgccaggaggaactg
gagtttctacagaagcgaaaggtggtggtggctgaagcactgaagcaggtgttgcagctg
gaggaggacctgcagatggacgaggtaccgctcatagccatcatgtctactgggggtgga
acaagatccatgactgccatgtatgggcacctgctggggctgcagaagctgaacctcctg
aattgtgccagctacatcactggcatatcaggggctacctggaccatggctaatttgtac
cgtgaccctgactggtcctccaaaaacctggagtctgccatcctcgaggcccggaggcat
gtggtcaaggacaagatgcccatcctgtacccagaccagctgttcagataccaggaggag
ctccagcagcgcagcaaggaaggctacaaggtcaactttacagacttctggggcctgctg
attgaggcctgtctgggggacgagagaaatgaatgcaaactgtcagagcagcgtgctgct
ttgagccagggccagaaccccctgcccatctatctcaccatcaatgtcaaggatgatgta
agcaaccaggatttcagagagtggtgtgagttttccccctacgaggtaggcatgcagaag
tatggagccttcgtccccaccgagctcttcggctctgagttcttcatggggcggctgatg
aagaggataccagagtctcggatgtgctacatgcttggattgtggagcagcatcttttcc
gtgaacctgctcgatgtttggaatttttgtagcacttcagacgagtttttccacaggtgg
acgagagagaaggtgcaagacatcgaagatgagcctctccttcctgaaatccccatatgt
gatgccaacgtcctggacacttcggtggtggtcccagcgtcgtggctgtctaataccttc
cgccacatcctcacccatcggtcctttgtgtctgagttccacaacttcctactggggttg
cagctgcacaccaactacctccagaatggccagttctccatgtggaaagacactgtgctt
gacggcttcccgaaccagctgacagggtccgtgaaccacttgagtctactggacacagca
ttcttcgtcaactctagctacccaccactcctcaggcctgagagaaaacccgacctcatc
attcatctcaattattgtgcggggtcccagacaaagcctatgaaacaaacctgtgagtac
tgcaccgagaagaatatccccttccccaaatatgacctgcaagaggaagagaatgataat
ctcaaggaatgctacctgttggaaaactcccaagaacctgatgctcccatcgtgcttttc
ttcccactcatcaatgacaccttccaaaagtacaaggctccaggtgtggaacgaagccct
gaggagatggagaagggccaggttgacatttatggccccaaaactccctattccaccaag
gagctgacgtacacagaagccgcctttgacaaaatggtgaatctctgtgagtacaacatc
ctgaataacaaggaccagctccttcaggccttgcgaatggcagtggagaagaagaaactc
tggaagagccggtgtccctcctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510922
Entry
107510922         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 beta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107510922
   00565 Ether lipid metabolism
    107510922
   00590 Arachidonic acid metabolism
    107510922
   00591 Linoleic acid metabolism
    107510922
   00592 alpha-Linolenic acid metabolism
    107510922
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510922
   04014 Ras signaling pathway
    107510922
   04370 VEGF signaling pathway
    107510922
   04072 Phospholipase D signaling pathway
    107510922
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107510922
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107510922
   04664 Fc epsilon RI signaling pathway
    107510922
   04666 Fc gamma R-mediated phagocytosis
    107510922
  09152 Endocrine system
   04912 GnRH signaling pathway
    107510922
   04913 Ovarian steroidogenesis
    107510922
   04921 Oxytocin signaling pathway
    107510922
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510922
  09156 Nervous system
   04724 Glutamatergic synapse
    107510922
   04726 Serotonergic synapse
    107510922
   04730 Long-term depression
    107510922
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510922
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107510922
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107510922
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107510922
NCBI-ProteinID: XP_016000378
LinkDB
Position
Unknown
AA seq 784 aa
MALAKVPGTCLLTXRVLQARGLPSKDLVTPSDCYVTLWLPTASSDRLRTRTVRNSRNPIW
NQSFRFQIHSQVKNVLQLQVFDQDLLTSDDPVLSVLFDVGTLRVGEFRSESFTLNPQGEE
KLEVEFRLQNLTDRAEQLFSNGILVARELSCLRVRLEEAGDQQGSKGKVHLVVPGSCEGP
QEATVGAGSLHFHCPACWEPELSVRLQDASQEQLKVPLRALPSRQVVRLVFPMSQEPLMR
VELKKEEGPKELAVRLGCEPCAEEQAFLSRRKQVVAKALKQALKLDGDLQEDEIPVVAVM
ATGGGVRAMTSLYGQLAGLRELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPIE
LLKTQVTKSKLGVLAPSQLQRYRQEMAERAHLGYPTCFTNLWALINEALLHDEPSDHKLS
DQRKALSHGQNPLPIYCALNTKEKNMTTFEFGEWCEFSPYEVGFPKYGAFIPPELFGSEF
YMGRLTKQLPESRICFLEGIWSNLYAASLQDSLYWSSEPSQFWDRWAQDQVSLDKEQTPL
LKIEETPTTACRIAEFFTDLLTRRPLAQATHNFMRGLHFHKDYFQHPHFAAWKATKLDGF
PNQLTPAESHLCLLDVGYLINTSCMPLLRPTRDVDLILSLDYNLHGAFQQLQLLGRFCGE
QRIPFPPISLSPEEQRQPQECHLFLHPDCPEAPAVLHFPLVNDSFREHSAPGVPRTAEEK
EAGEVNLSSSSSPYHYSKVTYSQEDVDKLLRLTHYNICNNREQLLEALREAVLRRRQRRQ
LQPQ
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggctctggcaaaggtgcctgggacctgcctgctcacgnttcgtgtcctgcaggcccgt
ggcctgccctccaaggacttagtgaccccctctgactgttatgtgactctgtggctgccc
acggcctccagcgacaggctccggacacgcacagttagaaacagcagaaaccccatctgg
aatcagagctttcgcttccaaatccacagccaggtcaagaatgtcctacaactgcaagtg
tttgaccaggaccttttgaccagtgatgaccccgtgttgtcggtgctgtttgatgtaggg
actttgagagttggggagttccgcagtgagagcttcaccctaaaccctcagggtgaggag
aagctggaagttgaatttcggctgcagaatctaacagaccgtgctgagcagctcttcagc
aatggcatcctggtggcccgggagctttcctgcttgcgtgttcgactggaagaggcaggg
gaccagcagggttcaaaaggcaaagttcaccttgtggtccctgggtcctgtgagggtcct
caggaagccacagtgggcgctggctccttgcacttccactgcccagcctgctgggagccg
gagctgagtgttcgtttgcaggatgcctcccaggagcaactgaaggtacccctgagggct
ctgccctctcgtcaagtggttaggctcgtcttccctatgtcccaggagcccctgatgagg
gtggagctgaaaaaagaagaaggaccgaaggagctggccgtgcggctgggctgcgagccc
tgtgcagaggagcaggccttcctgagcaggaggaagcaggtggtggccaaggccctgaag
caggccctgaagctggatggagacctgcaggaggacgagatcccagtagtagctgttatg
gccactggtggtggggtccgtgcgatgacttctctgtatgggcagctggctggcctgagg
gagctgggcctcttggattgtgtttcctacatcacaggggcctcaggctccacttgggct
ttggccaacctctatgaagacccagagtggtctcagaaggacctggcagggcccattgag
ttgctgaagacccaggtgaccaagagcaagctaggcgtgttggcccccagccagctgcaa
agataccggcaggagatggccgagcgtgcccacctgggctacccaacctgtttcactaac
ctgtgggccctcatcaatgaggcgctgctgcatgatgagcccagtgaccacaaactctca
gaccagcggaaggccctgagtcatggccagaaccctctgcccatctactgtgccctcaac
accaaggaaaagaacatgaccacctttgagtttggggagtggtgtgagttctccccctat
gaggttggctttcccaagtatggcgccttcatcccccccgagctctttggctctgagttc
tacatgggacgcctgacaaagcaacttcctgagtcccgcatctgcttcctggaaggtatc
tggagcaacctgtatgcagccagcctccaagacagtttatactggtcctcagagcccagc
cagttctgggaccgctgggcgcaggatcaggtcagcctggacaaggagcagacccctctt
ttgaagatagaagaaactcccacaacagcatgcaggatagctgagtttttcactgacctt
ctgacgcggcgcccacttgcccaggccacccacaacttcatgcgtggccttcatttccac
aaggactatttccagcatcctcacttcgccgcctggaaagccaccaaactggatgggttc
cccaaccagctgacacctgcggagtcccacctttgcctgctagatgtcggctaccttatt
aacaccagctgcatgcctctcctgcggccaacacgggatgtggacctcatcctgtcactg
gattacaacctccacggagcctttcagcaactgcagctcctgggccggttctgcggggag
cagaggatcccgttcccacccatctcactgagccctgaggagcagcgccagcctcaggag
tgtcacctgttcttgcaccccgactgccctgaagcccctgctgtgctacacttccccctg
gtcaatgactccttccgggagcactcggcccctggggtcccacggacagctgaggagaag
gaagctggggaggtgaacctctcttcctccagctccccctaccactactcgaaggtgacc
tacagccaggaggatgtggacaagctgctccgcctgacacattacaacatctgcaacaac
cgggagcagctgctggaggccctgcgtgaggctgtgctgcggcggaggcagcgcaggcag
ctccagccccagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510924
Entry
107510924         CDS       T06036                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107510924 (PLA2G4F)
   00565 Ether lipid metabolism
    107510924 (PLA2G4F)
   00590 Arachidonic acid metabolism
    107510924 (PLA2G4F)
   00591 Linoleic acid metabolism
    107510924 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    107510924 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510924 (PLA2G4F)
   04014 Ras signaling pathway
    107510924 (PLA2G4F)
   04370 VEGF signaling pathway
    107510924 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    107510924 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107510924 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107510924 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    107510924 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    107510924 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107510924 (PLA2G4F)
   04913 Ovarian steroidogenesis
    107510924 (PLA2G4F)
   04921 Oxytocin signaling pathway
    107510924 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510924 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    107510924 (PLA2G4F)
   04726 Serotonergic synapse
    107510924 (PLA2G4F)
   04730 Long-term depression
    107510924 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510924 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107510924 (PLA2G4F)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107510924 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107510924
NCBI-ProteinID: XP_016000382
LinkDB
Position
Unknown
AA seq 849 aa
MLWALWPRWLAGKGLPLLGVMLLRKRDKRGSQWSHWQRETHPYYDLQVKVLRARNIQGTD
LLSKADCYVQLWLPTASPSRAQTRMVANCSDPEWNETFHYQIHAAVKNVLELTLCDKDIL
GSKKLSVLLFDLESLKPGQPHRHTFPLNQQDSQELQVEFVLENSQVPASEVITNGVLVAH
PCLRIQGTLGGDATAPHQEYGSRQIRLVVPGAYEKPQLLPLQPPLEAEPPATFTFHVNPV
LHSRLDVELGENLMVLQSDPSAELEAQSSKLGEGGILLSSLALGQEEQRLVALGEGQEVT
LNVKAEMSSGDLDLRLGFDLCDGEQKFLDKRKQIVSKALQQVLKLNQAPDSDQVPVVAVL
GSGGGTRAMSSLYGSLTGLQELGLLDTVTYLKGVSGSTWCISTLYKDPAWSQVALQGPTE
LARGRVCSSKIGAVSTERLQYYAQELGKLESSGHSISLIDLWGLLIEYFLYQEENPAKLS
DQQEAISQGQNPYPIYASINVRTNISGEDFAEWCEFTPHEIGFPKYGAYIPTKLFGSEFF
MGRLLKLWPEPRICYLQGMWGSAFAASLDEIFMKTAGFSLSFLDLHRGHVNITDDCQKLQ
LHDPTRLRTKLFTRQGPFSQAVLDIFTSRFTAAENFNFTQGLCLHKDYVAGREFTAWKDT
HLDALPNELTPMRDCLYLVDGGFALNSPFPLSLLPQRAVDLIVSFDYSLDAPFEVLQMTE
KYCRDRGIPFPRVEVLPEDLEEPRECYLFDRAEDPCSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAHGDFAINGPDTPYGMTNFTYEPEEFDRLVALSRYNVLNNAETVRRALRLALDR
RQAGARAGG
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgctctgggcgttgtggcctaggtggctggcaggcaaggggctacccctcctgggggta
atgctgctgcggaagagagacaaaaggggatctcagtggagtcactggcagcgggaaacc
cacccatactatgacctccaggtgaaggtgctgagggccagaaatatccagggcacagat
ctgttgtccaaagctgactgctatgtgcaactgtggctgcccacggcatcccccagccgt
gcccagacaaggatggtggccaactgcagtgaccccgagtggaacgagactttccactac
cagatacatgctgctgtgaagaatgtcctggagctcaccctctgtgacaaggacatcctg
ggtagcaagaagctctctgtgctgctgtttgacctggagagcctcaagcctggccaaccc
cacagacacactttcccactcaaccaacaggattcacaagagctgcaggtggagtttgtt
ctggagaacagccaagtacctgcatctgaagtcatcaccaatggtgtcctggtggctcat
ccctgtctgagaatccagggcacccttgggggagatgcaacagcccctcatcaagaatat
ggttctaggcagattcggttggtagtgcccggggcctacgagaaaccacagctcttgcct
ctgcagcctcccttggaggcagaacccccagccacttttaccttccatgtgaatccagtg
ctacactccaggctggatgtcgagctgggagagaatctcatggtcctgcagagtgaccca
agtgctgagttggaggcccagagcagcaagctgggagaggggggcatcctgctctcttct
ctggccttaggccaggaggagcagcgcttggtggccctgggggagggccaggaggtaact
ctgaatgtgaaggcagaaatgagctctggagaccttgacctgcgccttggctttgacctc
tgtgatggagaacagaagtttctggacaagaggaagcagatcgtgtctaaggctttgcag
caggtgctgaaactgaaccaggctcctgacagtgaccaggtacctgtggtggctgtgctg
ggttcgggaggcggaacccgtgctatgtcttccctgtatggcagcctgacagggctgcag
gagcttggcctcttggacactgtgacctacttgaaaggggtttctgggtccacctggtgc
atctccacactctacaaagacccagcctggtcccaggtggctttgcagggccccactgag
cttgcccggggtcgggtctgcagcagtaagataggggcggtatccacggaacgtctacaa
tactatgcccaggaactggggaaactggaaagcagtggtcacagcatttccctcatcgac
ctctggggcctcctcattgaatatttcctataccaagaggaaaaccctgccaaactgtct
gaccaacaggaggcaatcagccagggccagaacccttatcccatctatgccagcatcaat
gtccgtaccaacatcagtggggaagactttgcagagtggtgtgagttcaccccccacgag
atcggcttccccaagtatggggcttatattcccaccaagctctttggctcagagttcttc
atggggcgactgctgaagctctggccagagccccggatctgctacttgcagggtatgtgg
ggcagtgcctttgcagccagcctggatgagattttcatgaagactgctggcttcagcctc
agcttcctggacttgcaccgaggccatgtaaacatcacagatgactgccagaagctccag
ttgcatgaccccaccaggctgcgaacaaagctcttcactcggcaggggcccttctcccag
gctgtgctggacatattcacgtcccgctttaccgccgcggagaacttcaacttcacccag
ggcctctgcctgcacaaggactatgtggctggcagggagttcacggcctggaaagacact
cacctggacgccttgcccaatgagctcactcctatgagggactgcctgtacctggtggac
gggggctttgctctcaactccccattcccactgagcctgctgccgcagagagcagtggac
ctcattgtgtcctttgactactccctggatgccccttttgaggtcttacagatgacagag
aagtactgccgggaccgaggcatcccctttcccagggtcgaggtgctccctgaggacctg
gaggaaccccgtgagtgctacctgtttgacagagctgaggacccttgctcacccatcgtg
ctgcacttccctcttgtcaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagccgaggagaaggcccatggagactttgccatcaacgggccagacacgccctat
ggcatgacgaacttcacctatgagcccgaggagttcgatcggctggtggccctgagtcga
tacaacgttctgaacaacgcggagactgtgaggcgtgccctccggctggctctggaccgg
cggcaggctggagccagggctggaggctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510925
Entry
107510925         CDS       T06036                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107510925 (PLA2G4D)
   00565 Ether lipid metabolism
    107510925 (PLA2G4D)
   00590 Arachidonic acid metabolism
    107510925 (PLA2G4D)
   00591 Linoleic acid metabolism
    107510925 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    107510925 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510925 (PLA2G4D)
   04014 Ras signaling pathway
    107510925 (PLA2G4D)
   04370 VEGF signaling pathway
    107510925 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    107510925 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107510925 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107510925 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    107510925 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    107510925 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107510925 (PLA2G4D)
   04913 Ovarian steroidogenesis
    107510925 (PLA2G4D)
   04921 Oxytocin signaling pathway
    107510925 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510925 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    107510925 (PLA2G4D)
   04726 Serotonergic synapse
    107510925 (PLA2G4D)
   04730 Long-term depression
    107510925 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510925 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107510925 (PLA2G4D)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107510925 (PLA2G4D)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107510925
NCBI-ProteinID: XP_016000383
LinkDB
Position
Unknown
AA seq 825 aa
MERLTSRGPPGHPHQGVASVCWWLTVRVLEARGLGWADMLSEADPYVVLQLSTAPGIKFK
TKTVTNSSHPVWNETFSFLIQSQVKNVLQLSVYDEDSVTEDDVCFQFLYDVSEVLPGKLL
RKTFSLSPQRQEELDVEFLMEKTSDRPENLITNNVLVARELSCLDVRLKNTGSTAVVASE
TRSEPDQDKLELELELVLKGSYEDTQTSALSTASAFRFHYMEAQEAELSGHLRSSKSNDW
NSASSAGHLTVPLRSLVVGKEMTMDIPATNAPGVRLQLKTEGCQKEPAVRLGFDLCAEEQ
AFLSRRKQVVAKALKQALQLDGDLQEDEVPVVGIMATGGGARAMTSLYGHLLALKKLGLL
DCVTYFSGISGATWTMAQLYADPEWSQRDLERPIQYAREHLTKSKLETFSPERLANYRRE
LELRAEQGHPTTFVDLWALVLESMQHGQVMDQKLSGQRAALEQGQNPLPLYLSLNVKENN
LKTFDFKEWVEFSPYEVGFLKYGAFVPSELFGSEFFMGRLMRRIPESRICFLEGIWSNIF
SLNLLEAWYDLTSSDDDQKQRIKDKIRKLEKPPASSKTSSWLEALWLQPGTALAQAFKGF
LTNRPLYQHSSNFLQGLQLHQDYCDQKDFSTWADSQLDSIPGQLTPQEPHLCLVDAGHFL
NTSCPSMLRPSRRLDLILSFDYSQKPFEVLQQTKLYCQGLGLPFPHLEPSLQEQCQPKEC
HLFSDPTCPDAPVLLHFPLVNVSFKDYSAPGVQRSPAELPDGQVDLNPDTSPYSLFSTTY
KEEDFDRLLQLSDYNVQNSQGTILQALRMALKRRAPGARLPGAQT
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggagagactgacatctaggggaccacctggccatcctcatcagggggtggcctctgtc
tgctggtggctcacggtgagggtcctggaagctcgaggcctgggctgggctgacatgttg
agcgaggcagacccttacgtggtcctacagctgtcaactgcacctggaattaagtttaag
accaaaactgtcaccaactccagtcatcctgtatggaatgagaccttcagtttcctaatc
cagagtcaggtcaagaatgttctgcaactgagcgtctatgatgaggattcagtcacggag
gatgatgtctgtttccagtttctctatgacgtctcagaagtcctgcctggcaaacttctc
cggaagaccttctccctgagtccccagagacaagaggaactggatgtggagttcctgatg
gaaaaaacgtctgaccgcccagaaaacctcatcaccaacaacgtccttgtggcgcgggag
ctgtcatgcctagatgtccgtctgaagaacacggggagcacagccgtggtagcaagtgag
acccgctcagaaccagatcaggacaagctggagctggagttggagctggtgctaaagggg
tcatatgaggacacacagacatctgctctgagcacagcctctgccttccgctttcactac
atggaggctcaagaggcagagctgagtgggcatctgaggagctccaaaagcaatgactgg
aactcagctagctcagctggacacctcactgtgcccctgaggtccttggttgtggggaag
gagatgaccatggacattcctgctacgaatgccccaggagtgaggctgcagctcaagact
gagggctgccagaaggagccggctgttcgcctgggctttgatctgtgtgcagaggagcag
gccttcctgagcaggaggaagcaggtggtggccaaggccctgaagcaggccctgcagctg
gacggagacctgcaggaagatgaggtccccgtcgtgggcatcatggccacaggaggaggt
gcccgggccatgacttctctctatggccatctgttggccctgaaaaagctgggactcctg
gactgcgtgacctatttcagtggcatctcgggagctacatggacaatggcccaactatat
gcggatcctgagtggtcacagagggacctcgagagacccatccagtatgcccgggaacac
ctcaccaagagcaagctggagaccttctccccagaacgtctggcaaactaccgcagggag
ctggagctgcgggcggagcaaggccacccgacgaccttcgtggacctgtgggctctggtg
ctggagtccatgcagcacggtcaggtgatggatcagaagctttcaggacagagagctgca
ctggagcagggccagaaccctctgcccctctacttgagcctcaatgtcaaagagaacaat
ctgaagactttcgacttcaaggagtgggttgagttctccccttatgaggtcgggttcctg
aagtatggagcctttgtcccttctgagctctttggctccgagttcttcatggggcggctg
atgaggaggatcccagagtcccggatctgctttctagaaggtatctggagcaacattttc
tccctgaacttgctggaagcctggtatgatctcaccagctctgatgatgaccagaagcaa
cgcatcaaggacaagatcaggaaactagagaagccccctgcctcctcaaagacttcctca
tggctggaggccttgtggctgcagcctggaaccgcactggcccaggcatttaagggcttc
ctgacaaaccggccactctaccagcatagctccaacttcctccagggcctccagctgcat
caggactactgcgaccagaaagatttctctacctgggcagacagccagctagactccatc
cctggccagctgaccccgcaggagcctcatctctgcctggtggatgctggccactttctc
aacaccagctgtccctccatgctccgaccaagccgcaggctggatctcatactctccttc
gactactctcagaagccttttgaggtgctgcagcagaccaagctgtactgccagggcctg
ggactgcctttcccccacttggagcccagcctgcaggaacaatgccagcccaaggagtgc
cacctcttctcagacccgacctgcccagatgctcctgtcctattgcatttcccactggtc
aatgtctccttcaaggactactcagcacctggtgtccagcgcagccctgcagagctccca
gacggccaggtggatctgaatccggacacctcaccctattccctgttcagcacgacctac
aaggaggaagactttgaccgcttgctgcaactcagtgattacaatgtccagaatagccag
ggcaccatcctgcaggccttgagaatggctctgaagcgccgggccccgggggccaggctt
ccaggggcacaaacttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514503
Entry
107514503         CDS       T06036                                 

Definition
(RefSeq) cytosolic phospholipase A2 beta-like isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107514503
   00565 Ether lipid metabolism
    107514503
   00590 Arachidonic acid metabolism
    107514503
   00591 Linoleic acid metabolism
    107514503
   00592 alpha-Linolenic acid metabolism
    107514503
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107514503
   04014 Ras signaling pathway
    107514503
   04370 VEGF signaling pathway
    107514503
   04072 Phospholipase D signaling pathway
    107514503
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107514503
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107514503
   04664 Fc epsilon RI signaling pathway
    107514503
   04666 Fc gamma R-mediated phagocytosis
    107514503
  09152 Endocrine system
   04912 GnRH signaling pathway
    107514503
   04913 Ovarian steroidogenesis
    107514503
   04921 Oxytocin signaling pathway
    107514503
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107514503
  09156 Nervous system
   04724 Glutamatergic synapse
    107514503
   04726 Serotonergic synapse
    107514503
   04730 Long-term depression
    107514503
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107514503
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107514503
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107514503
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107514503
NCBI-ProteinID: XP_016007770
LinkDB
Position
Unknown
AA seq 787 aa
MALVRQAKVPGTCLLTVRVLQARGLPSKDLVTPSDCYVTLWLPTASSDRLRTRTVRNSRN
PIWNQSFRFQIHSQVKNVLQLQVFDQDLLTSDDPVLSVLFDVGTLRVGEFRSESFTLNPQ
GEEKLEVEFRLQNLTDRAEQLFSNGILVARELSCLRVRLEEAGDQQGSKGKVHLVVPGSC
EGPQEATVGAGSLHFHCPACWEPELSVRLQDASQEQLKVPLRALPSRQVVKLVFPMSQEP
LMRVELKKEEGPKELAVRLGCEPCAEEQAFLSRRKQVVAKALKQALQLDGDLQEDEIPVV
AVMATGGGVRAMTSLYGQLAGLRKLGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAG
PIELLKTQVTKSKLGVLAPSQLQRYRQEMAERAHLGYPTCFTNLWALINEALLHDEPSDH
KLSDQRKALSHGQNPLPIYCALNTKEKNMTTFEFGEWCEFSPYEVGFPKYGAFIPPELFG
SEFYMGRLTKQLPESRICFLEGIWSNLYAASLQDSLYWSSEPSQFWDRWAQDQVSLDKEQ
VPLLKIEETPTTAGRIAEFFTDLLTRRPLAQATHNFMRGLHFHKDYFQHPHFAAWKATKL
DGFPNQLTPAESHLCLLDVGYLINTSCMPLLRPTRDVDLILSLDYNLHGAFQQLQLLGRF
CGEQRIPFPPISLSPEEQRQPQECHLFLHPDCPEAPAVLHFPLVNDSFREHSAPGVPRTA
EEKEAGEVNLSSSSSPYHYSKVTYSQEDVDKLLRLTHYNICNNREQLLEALREAVLRRRQ
RRQLQPQ
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctctggtaagacaggcaaaggtgcctgggacctgcctgctcaccgttcgtgtcctg
caggcccgtggcctgccctccaaggacttagtgaccccctctgactgttatgtgactctg
tggctgcccacggcctccagcgacaggctccggacacgcacagttagaaacagcagaaac
cccatctggaatcagagctttcgcttccaaatccacagccaggtcaagaatgtcctacaa
ctgcaagtgtttgaccaggaccttttgaccagtgatgaccccgtgttgtcggtgctgttt
gatgtagggactttgagagttggggagttccgcagtgagagcttcaccctaaaccctcag
ggtgaggagaagctggaagttgaatttcggctgcagaatctaacagaccgtgctgagcag
ctcttcagcaatggcatcctggtggcccgggagctttcctgcttgcgtgttcgactggaa
gaggcaggggaccagcagggttcaaaaggcaaagttcaccttgtggtccctgggtcctgt
gagggtcctcaggaagccacagtgggcgctggctccttgcacttccactgcccagcctgc
tgggagccggagctgagtgttcgtttgcaggatgcctcccaggagcaactgaaggtaccc
ctgagggctctgccctctcgtcaagtggttaagctcgtcttccctatgtcccaggagccc
ctgatgagggtggagctgaaaaaagaagaaggaccgaaggagctggccgtgcggctgggc
tgcgagccctgtgcagaggagcaggccttcctgagcaggaggaagcaggtggtggccaag
gccctgaagcaggccctgcagctggatggagacctgcaggaggacgagatcccagtagta
gctgttatggccactggtggtggggtccgtgcgatgacttctctgtatgggcagctggct
ggcctgaggaagctgggcctcttggattgtgtttcctacatcacaggggcctcaggctcc
acttgggctttggccaacctctatgaagacccagagtggtctcagaaggacctggcaggg
cccattgagttgctgaagacccaggtgaccaagagcaagctaggcgtgttggcccccagc
cagctgcaaagataccggcaggagatggccgagcgtgcccacctgggctacccaacctgt
ttcactaacctgtgggccctcatcaatgaggcgctgctgcatgatgagcccagtgaccac
aaactctcagaccagcggaaggccctgagtcatggccagaaccctctgcccatctactgt
gccctcaacaccaaggaaaagaacatgaccacctttgagtttggggagtggtgtgagttc
tccccctatgaggttggctttcccaagtatggcgccttcatcccccccgagctctttggc
tctgagttctacatgggacgcctgacaaagcaacttcctgagtcccgcatctgcttcctg
gaaggtatctggagcaacctgtatgcagccagcctccaggacagtttatactggtcctca
gagcccagccagttctgggaccgctgggcgcaggatcaggtcagcctggacaaggagcag
gtccctcttttgaagatagaagaaactcccacaacagcaggcaggatagctgagtttttc
actgaccttctgacacggcgcccacttgctcaggccacccacaacttcatgcgtggcctt
catttccacaaggactatttccagcatcctcacttcgccgcctggaaagccaccaaactg
gatgggttccccaaccagctgacacctgcggagtcccacctttgcctgctagatgtcggc
taccttatcaacaccagctgcatgcctctcctgcggccaacacgggatgtggacctcatc
ctgtcactggattacaacctccacggagcctttcagcaactgcagctcctgggccggttc
tgcggggagcagaggatcccgttcccacccatctcactgagccctgaggagcagcgccag
cctcaggagtgtcacctgttcttgcaccccgactgccctgaagcccctgctgtgctacac
ttccccctggtcaatgactccttccgggagcactcggcccctggggtcccacggacagct
gaggagaaggaggctggggaggtgaacctctcttcctccagctccccctaccactactcg
aaggtgacctacagccaggaggatgtggacaagctgctccgcctgacacattacaacatc
tgcaacaaccgggagcagctgctggaggccctgcgtgaggctgtgctgcggcggaggcag
cgcaggcagctccagccccagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521615
Entry
107521615         CDS       T06036                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107521615 (PLA2G4A)
   00565 Ether lipid metabolism
    107521615 (PLA2G4A)
   00590 Arachidonic acid metabolism
    107521615 (PLA2G4A)
   00591 Linoleic acid metabolism
    107521615 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    107521615 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107521615 (PLA2G4A)
   04014 Ras signaling pathway
    107521615 (PLA2G4A)
   04370 VEGF signaling pathway
    107521615 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    107521615 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107521615 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107521615 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    107521615 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    107521615 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107521615 (PLA2G4A)
   04913 Ovarian steroidogenesis
    107521615 (PLA2G4A)
   04921 Oxytocin signaling pathway
    107521615 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107521615 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    107521615 (PLA2G4A)
   04726 Serotonergic synapse
    107521615 (PLA2G4A)
   04730 Long-term depression
    107521615 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107521615 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107521615 (PLA2G4A)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107521615 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 107521615
NCBI-ProteinID: XP_016021941
LinkDB
Position
Unknown
AA seq 741 aa
MFLVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISSTPDSRKRTRHFNNDIN
PVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPISFMKVGEKKEVPFIFNEVT
EMILEMSLEVCSSPDLRFSMALCDQEKAFRYRRKENIRENMKKLLGPENSEGLSSTRDVP
VVAILGSGGGFRAMVGFSGVMKALYESGILDCTTYVAGLSGSTWYMSTLYSHPDFPEKGP
EEINEELMKNVSYNPLLLLTPQKVKRYVESLWKKKRSGQPVTFTDIFGMLIGETLIHNRM
NITLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMAPDLF
GSKFFMGKVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSSSQNKGSTMEEELENITAKH
IVSNDSSDSDDESQEPKGTENEDAERDYQNDNQASWVHRMIMALMSDSALFNTREGRAGK
VHNFMLGLNLNTSYPLSPFRDFTTQESLDEDELDAAVADPDEFEQIYEPLDVKSKKIHVV
DSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMNKLPFPKID
PYVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRKYKAPGVPRETTEEKEIADF
DIFDDPESPFSTFNFQYPNQAFKRLHDLMYFNTLNNIDVIKNAIIESIEYRRQNPSRCSV
SLSNIEARKFFNKEALSKPTA
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgtttctagtggagcaccagtattcccacaagttcacagtagtggtgttacgtgccacc
aaagtgacaaagggggccttcggtgacatgcttgacactccagacccctacgtggaactt
ttcatctcctcaactcccgacagcaggaagagaacgagacactttaataatgacataaac
cctgtgtggaatgagacctttgaatttattttggacccgaatcaggaaaatgttttggag
atcacgttaatggatgccaattatgtcatggatgaaactcttggaacagcaacgtttccc
atatcttttatgaaagtaggagagaagaaagaggttccttttattttcaacgaagtcact
gaaatgatcctggaaatgtcccttgaagtttgctcatccccagacctccgatttagcatg
gctctgtgtgatcaggagaaagctttcaggtaccggaggaaagaaaacatcagggaaaac
atgaagaaactcctgggtccggagaacagcgaaggcttgtcttctacacgcgatgtacct
gtggtcgccatactgggctcaggtggagggtttcgagccatggtaggattctccggcgtg
atgaaggcactgtatgaatcaggaattttggattgcactacttatgttgctggtctttct
ggctccacatggtacatgtcaaccttatattctcaccctgattttccagagaaagggcca
gaggagattaatgaagagctaatgaaaaatgttagctataacccccttttacttctcaca
ccacagaaagttaagagatatgttgagtctttatggaagaagaaaaggtctggacaacct
gtcacctttacggatatctttggaatgttaataggagaaacactaattcacaatagaatg
aacattaccttgagtagtttgaaggaaaaagtcaatactgcacaatgccctttacctctt
ttcacctgtctgcatgtcaaacctgatgtttcagaactgatgtttgcagattgggttgaa
tttagtccgtatgagattggcatggctaaatacggtacttttatggctcctgacttattt
ggaagcaaattttttatgggaaaagttgtgaagaaatacgaagaaaaccccttgcatttc
ctaatgggtgtctggggcagcgccttttctatattgttcaacagagtcttgggagtttcc
agttcacaaaataaaggttccaccatggaggaagaattagaaaacattacggcaaagcat
attgtgagtaatgatagctcagatagcgatgatgaatcacaagaacccaaaggcactgaa
aatgaagatgccgaaagagactatcaaaatgataatcaagcaagttgggtccatcgtatg
ataatggccttgatgagcgattcagctctattcaataccagagaaggacgtgctgggaag
gttcacaacttcatgctgggcttgaatctcaatacatcttatccactgtctcctttcaga
gacttcaccacacaggagtccttggatgaagatgaacttgatgcagctgtagcagatcct
gatgaatttgagcaaatatatgagcctctggatgtcaaaagtaaaaagattcacgtagta
gacagtggcctcacatttaacctaccttatcccttgatcctgagacctcagaggggagtt
gatctcatcatctcctttgacttttctgcaagaccaagtgactctagtcctccgttcaag
gaacttctacttgcagaaaaatgggctaaaatgaacaagcttccctttccaaagattgac
ccttatgtgtttgatcgagaaggactaaaggagtgttatgtctttaaacccaagaatcct
gatgtagagaaagattgcccgacgatcattcacttcgttctggccaacatcaacttcaga
aagtacaaggctccaggtgttccaagagaaactacagaagagaaagaaatagctgatttt
gatatttttgatgacccggaatcaccgttttcaaccttcaacttccaatatccaaatcaa
gcattcaaaaggctgcatgatctgatgtacttcaacaccctgaacaacatcgatgtaata
aagaatgccatcattgaaagcatcgaatacagaaggcagaatccatctcgctgttctgtt
tccctcagtaacattgaggcaagaaaatttttcaacaaggaggctctaagcaaacccaca
gcataa

DBGET integrated database retrieval system