KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511070
Entry
107511070         CDS       T06036                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04540  Gap junction
ray04657  IL-17 signaling pathway
ray04722  Neurotrophin signaling pathway
ray04912  GnRH signaling pathway
ray04921  Oxytocin signaling pathway
ray05206  MicroRNAs in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107511070 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107511070 (MAPK7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107511070 (MAPK7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107511070 (MAPK7)
   04921 Oxytocin signaling pathway
    107511070 (MAPK7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107511070 (MAPK7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107511070 (MAPK7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107511070 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107511070 (MAPK7)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107511070 (MAPK7)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107511070 (MAPK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH
Other DBs
NCBI-GeneID: 107511070
NCBI-ProteinID: XP_016000643
LinkDB
Position
Unknown
AA seq 811 aa
MAEPLKEEDGEDGTGEPPEPVKAEPANTNASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYSEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPSCPDIEMP
SPWAPSGDCAMESPPPAPLPCPGPAPDTIDLTLQPPPPPASEPTPPKREGAISDNTKAAL
KAALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERE
RKERGAGASGIPSTDPLAGLVLSDNDRSLLERWTRMARPPAPTLAPAHAPVPTPNLAQPT
SPPAGPKAQPTGPPLQPIGSTPGPQPACPPPGPASHPAGPSGPIPGPATLQTATSSSLLA
PQSLVPTPGLPGPSTLGVLPYFPSDPPPPDPRMAPQSSTSESPDVNLVTQQLSKSQVEDP
LPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGH
GMNSADIESLQREIQMDSPMLLADLPELQES
NT seq 2436 nt   +upstreamnt  +downstreamnt
atggccgagcccctgaaagaggaagacggcgaggacggcactggagagccccccgagccc
gtgaaggcggaacccgccaacaccaatgcctctgtagcggccaagaatctggcccttctt
aaagcccgctccttcgatgtgacctttgacgtgggggacgagtatgagatcatcgagacc
ataggcaacggggcttacggggtggtttcctctgcgcgccgccgactcactggccagcag
gtggccattaagaagatccctaatgctttcgacgtggtgaccaatgccaagcggaccctc
agggaactgaagatccttaagcacttcaagcatgacaacatcatcgccatcaaggacatc
ctgaggcccactgtgccctatagcgagttcaaatctgtctatgtggtcctggacctgatg
gagagtgacctgcaccagatcatccactcctcacagccactcacgctggagcatgtgcgc
tatttcctgtaccaactgctgcggggcctcaagtatatgcattcagctcaggtcatccac
cgcgacctcaagccctctaacctgttggtgaatgagaactgtgagctcaagattggtgac
tttggcatggcccgtggcctgtgtacctcgcctgctgagcaccagtacttcatgactgaa
tatgtggccactcgctggtaccgtgcccctgagctcatgctctcacttcatgagtacaca
caggctattgacctgtggtctgtgggctgcatctttggtgagatgctggccaggcgccag
ctcttcccaggcaaaaactatgtgcaccagctgcagctgatcatgatggtgctaggtacc
ccatcgccggctgtgattcaagctgtaggggctgaaagggtgcgggcgtatatccagagt
ctgccaccacgccagcctgtgccctgggagacagtgtacccaggcgctgaccgccaggcc
ctctcactgctagggagaatgctgcgttttgagcccagtgcccgcatctcagcagctgct
gcccttcgccaccccttcttggccaagtaccatgaccctgatgatgagcctgactgtgcc
ccaccctttgactttgcctttgaccgtgaagcccttacccgggaacggattaaagaggct
attgtggccgagattgaggacttccatgcacggcgtgagggcatccgtcaacaaatacgc
ttccagccttccctacagcctgtggctagtgagcctagctgtcctgacattgaaatgccg
agtccctgggctcccagtggggattgtgccatggagtcacctcccccagccccactgcca
tgccctggccctgcacctgacactattgatctgactctgcagccacctccccctccagcc
agtgaaccaactcctccaaagagggagggtgccatctcagacaacaccaaggcagccctc
aaagctgccctgctcaagtccttgcgaagccggcttagagatggccccagtgcccccttg
gaagcacctgagcctcggaagccagtgacagctcaggagcgccagcgggagcgggaggaa
aagcggcggcggcgacaggaacgagccaaggagcgggagaagcggcgacaggaacgggag
cgcaaggaacggggggcaggggcctctgggatcccctcaactgatcccctggctgggctg
gtgctcagtgacaatgatcgcagcctgctagagcgctggactcgcatggcccggccccca
gccccgaccctggcaccagcccatgccccagtgccaacacccaatctagcccagcccacc
agtcctcctgctggccctaaagcccagcccactggacccccactgcaacctataggctcc
actcctggtccacagcctgcctgtccaccccctggccctgcttcccaccctgctggccca
tctgggcccattcctggccctgctacactccagaccgccacctcttccagcctcctggcc
ccccagtcgcttgtgccaacccctgggctgcctggccccagcaccctgggggttctgcct
tacttcccatctgacccaccccctccagaccccaggatggctcctcagtcctccacctca
gagtcacctgatgtcaacctggtgacccagcagctgtccaagtctcaggtggaggacccc
ttgccccccgtgttctcaggcactccaaagggcagtggggctggctatggtgttggcttt
gacctggaggaattcttaaaccagtcttttgatatgggcgtggctgacgggccacaggat
ggccaggcagactcggcctcgctctcagcttcccttcttgctgactggctcgagggccat
ggcatgaactctgctgacattgagtccctgcagcgtgagatccagatggattccccaatg
ctgctggctgacctgcctgaactccaggagtcttga

DBGET integrated database retrieval system