KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511206
Entry
107511206         CDS       T06036                                 

Gene name
CXCR4
Definition
(RefSeq) C-X-C chemokine receptor type 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04060  Cytokine-cytokine receptor interaction
ray04061  Viral protein interaction with cytokine and cytokine receptor
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray04360  Axon guidance
ray04670  Leukocyte transendothelial migration
ray04672  Intestinal immune network for IgA production
ray04810  Regulation of actin cytoskeleton
ray05163  Human cytomegalovirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107511206 (CXCR4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107511206 (CXCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107511206 (CXCR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107511206 (CXCR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107511206 (CXCR4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107511206 (CXCR4)
   04672 Intestinal immune network for IgA production
    107511206 (CXCR4)
   04062 Chemokine signaling pathway
    107511206 (CXCR4)
  09158 Development and regeneration
   04360 Axon guidance
    107511206 (CXCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511206 (CXCR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107511206 (CXCR4)
   05163 Human cytomegalovirus infection
    107511206 (CXCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107511206 (CXCR4)
   04050 Cytokine receptors [BR:ray04050]
    107511206 (CXCR4)
   04090 CD molecules [BR:ray04090]
    107511206 (CXCR4)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    107511206 (CXCR4)
Cytokine receptors [BR:ray04050]
 Chemokine receptors
  CXC Chemokine
   107511206 (CXCR4)
CD molecules [BR:ray04090]
 Proteins
  107511206 (CXCR4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx DUF4538
Other DBs
NCBI-GeneID: 107511206
NCBI-ProteinID: XP_016000906
LinkDB
Position
Unknown
AA seq 353 aa
MDGFHIYPSDNYTEEDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLV
ILVMGYQKKLRSMTDKYRLHLSVADLLFVLTLPFWAVDAVANWYFGKFLCKAVHVIYTVN
LYSSVLILAFISLDRYLAIVHATNSQKPRKLLAEKVVYVGVWIPALLLAIPDFIFANVQV
GDDRYVCDRLYPNDLWLVVFQFQHILVGLILPGIVILSCYCIIISKLSHSKGYQKRKALK
TTVILILTFFACWLPYYIGISIDSFILLEIIKQGCDFENSVHKWISITEALAFFHCCLNP
ILYAFLGAKFKTSAQHALTSVSRGSSIKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggacgggttccatatatacccatcagataactacacagaggaggacttgggctcagga
gactatgactccatgaaggaaccttgcttccgggaggaaaatgcccatttcaaccgtatc
tttctgcctactgtctactccatcatcttcttgactggcattgtgggcaatggattggtc
atcctggtcatgggttatcagaagaaactgagaagcatgacagacaagtacagactgcat
ctgtcagtggcagacctcctctttgtcctcacgcttcctttctgggcagttgacgctgtg
gcaaactggtactttgggaagttcctgtgtaaagcagtccatgtcatctacacagtcaac
ctctacagcagtgtcctcatcctggccttcatcagtctagaccggtacctggctatcgtt
catgccaccaacagtcagaagccaaggaagctgttggctgaaaaggtcgtctatgttggc
gtctggatccctgctctcctgttggctattcccgatttcatctttgccaatgtccaggtt
ggggatgacaggtatgtctgtgaccgactctacccaaatgacttgtggttggtggtgttc
cagtttcagcacatcttggttggccttatactgccaggtatcgtcatcctgtcctgctat
tgcattatcatctccaagctgtcccactccaaggggtaccagaagcgcaaggccctcaag
accacagttatcctcatcttgactttcttcgcctgctggctaccctactacattgggatc
agcatcgactcctttatcctcctggaaatcatcaagcaaggatgtgactttgagaattct
gtgcacaagtggatttctatcaccgaggccctagcctttttccactgttgcctgaatccc
atcctctatgcctttcttggagccaaatttaaaacctctgcccagcacgcactcacctct
gtgagcagaggatccagcatcaagatcctctccaaaggaaagcggggtggacattcttct
gtttcaaccgagtctgagtcttcaagttttcactccagctaa

DBGET integrated database retrieval system