KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511388
Entry
107511388         CDS       T06036                                 

Gene name
SMC3
Definition
(RefSeq) structural maintenance of chromosomes protein 3
  KO
K06669  structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6)
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107511388 (SMC3)
   04114 Oocyte meiosis
    107511388 (SMC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107511388 (SMC3)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:ray00535]
    107511388 (SMC3)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    107511388 (SMC3)
  Meiosis-specific sister chromatid cohesion proteins
    107511388 (SMC3)
Proteoglycans [BR:ray00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   107511388 (SMC3)
SSDB
Motif
Pfam: SMC_N SMC_hinge AAA_15 AAA_21 AAA_23 OmpH AAA_29 Muted
Other DBs
NCBI-GeneID: 107511388
NCBI-ProteinID: XP_016001198
LinkDB
Position
Unknown
AA seq 1217 aa
MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQ
RLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKND
VMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMK
ETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYTIYNQELNETRAKLD
ELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIK
QRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEER
GIARLAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDL
EDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYLWREENAEQ
QALAAKREDLEKKQQLLRAATGKAILNGIDSINKVLDHFRRKGINQHVQNGYHGIVMNNF
ECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAY
PETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLEGDQVSH
RGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNIERINNEIDQLMNQMQQ
IETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAE
LGTDLLSQLSLEDQKRVDALNDEIRQLQQENRQLLNERIKLEGIITRVETYLNENLRKRL
DQVEQELNELRETEGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKS
MERWKNMEKEHMDAINHDTKELEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTL
SLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNV
LELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERG
SGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFY
LFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHIDV
ITAEMAKDFVEDDTTHG
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgtacataaagcaggttattatccagggttttcgaagttacagagatcaaacaattgta
gatcccttcagttcaaaacataatgttatcgtgggcagaaatggatctggaaaaagtaac
tttttttatgcaattcaatttgtgctcagtgatgagtttagtcatcttcgtccagaacag
cgattggctttgttgcatgagggtactggtcctcgtgttatttctgcttttgtggagatt
atttttgacaattcggataaccggttgccaatcgataaagaagaagtttcacttcgaaga
gttattggtgccaaaaaggatcagtatttcttagacaagaaaatggtcacgaaaaatgat
gtgatgaatctccttgaaagtgctggtttttctcgaagcaatccttattatattgttaaa
caaggaaagatcaaccagatggcaacagcaccagattctcagagactaaagctattaaga
gaagtagctggtactagagtatatgatgaacgaaaagaagaaagtatctctttaatgaaa
gaaacagagggcaaacgggaaaaaatcaatgagttgttaaaatacattgaagagagatta
cacaccttagaggaagaaaaagaagaactagctcagtatcagaagtgggataaaatgaga
cgagccctggaatataccatttacaatcaggaacttaatgagactcgtgctaaactcgat
gagctttctgctaagcgagagactagtggagaaaaatccagacaattaagagatgctcag
caggatgcaagagataaaatggaggacattgagcgccaagttagagaactgaaaacaaag
atttcagctatgaaagaggaaaaggagcagctcagtgctgaaagacaagaacaaataaag
cagaggactaaattggagcttaaagccaaggatttacaagatgaattggcaggcaatagt
gaacaaaggaaacggttattaaaagagaggcagaagctgcttgaaaaaatagaagaaaag
cagaaagaactggcagaaacagaacctaaattcaacagtgtaaaagaaaaagaagagcga
ggaattgctagattggcccaggctacccaggaaagaacagatctttatgcaaagcaaggt
cgaggaagccagtttacatcaaaagaagaaagagataaatggattaagaaggaactcaaa
tctttagaccaagctattaatgataagaaaagacagattgctgctatacataaagatttg
gaggacactgaggcaaataaagagaaaaatttggagcagtataataaactggatcaggat
cttaatgaagttaaagctcgagtagaagaactggacagaaaatactacgaagtgaaaaat
aagaaagatgaattacaaagtgaaagaaattacctgtggagagaggagaatgcagaacag
caagcactcgctgctaaaagggaagatcttgaaaagaaacagcaacttcttagagcggca
acaggaaaggccattttaaatggcatagacagcataaacaaagtgctagaccactttcgt
cgaaaaggaataaaccaacacgttcaaaatggttatcatggcattgtgatgaataacttt
gaatgtgagcctgctttctacacatgtgtagaagtcactgctggaaacaggttattttat
catattgttgattcagatgaagtcagtacgaagattttgatggagtttaataaaatgaat
cttcctggagaagttacttttctgcctcttaacaagttagatgtaagggatactgcctat
cctgaaaccaatgatgctattcctatgataagtaaattgagatacaatcccaggtttgat
aaagccttcaaacatgtatttggaaaaacacttatttgtcgaagtatggaagtttcaacc
cagctagcccgtgctttcactatggactgcattaccctggaaggtgaccaagttagtcat
cggggtgctctaactggaggttattacgacacaagaaagtctagacttgaattacaaaaa
gatgttagaaaagcagaagaagaactaggtgagcttgaagcaaagctcaatgaaaacctg
cgcagaaatattgaaaggattaataatgaaattgatcagttgatgaaccaaatgcagcag
atagagacccagcaaaggaaatttaaagcatctcgagatagcatattatcagaaatgaag
atgctaaaagagaagaggcagcagtcagagaaaacctttatgccgaagcaacgtagctta
caaagtttggaggcaagtttgcatgctatggagtccaccagagaatcattgaaagcagaa
ctgggaactgatttactttctcaacttagtctggaagatcagaagagagtagatgctcta
aatgatgaaatacgtcaacttcagcaggaaaacagacagttgctgaatgaaagaattaaa
ttagaaggtattattactcgagtagagacttatctaaatgagaatttgagaaaacgcttg
gaccaagtggaacaggaacttaatgaacttagagagacagaagggggtactgttctcact
gctacaacctcagaacttgaagctatcaataaaagagtgaaagatactatggcacgatca
gaagatttggacaattccatcgataaaacagaagccggaattaaggagcttcagaagagt
atggagcgctggaaaaatatggaaaaagaacacatggatgctataaatcatgatactaaa
gaactagaaaagatgaccaatcgacaaggcatgctactgaagaagaaagaagagtgtatg
aagaaaattcgagaacttggatcacttccccaggaagcatttgaaaaataccaaacactg
agcctcaaacagttgtttagaaaacttgaacagtgcaacacagaattgaagaagtacagc
catgttaacaaaaaagctttggatcagtttgtaaatttctctgagcagaaagaaaagtta
ataaagcgacaagaagagttggatagggggtacaaatcaatcatggaactgatgaatgta
cttgaacttcgaaaatatgaagctattcagttaacttttaaacaggtttccaagaacttc
agtgaagtattccagaagttggtacctggtggcaaagctactttggtgatgaagaaagga
gatgtggagggcagtcagtctcaggatgaaggagaagggagcggtgaaagtgagaggggt
tctgggtcacaaagcagtgtcccatcagttgaccagttcactggagttggaattagggta
tcatttacaggaaaacaaggtgaaatgagagaaatgcaacagctttcaggtggacagaaa
tccttggtagctcttgctctgatttttgccattcagaaatgtgacccagctcctttttac
ttgtttgatgagattgaccaggctctggatgctcagcacagaaaggctgtgtcagatatg
attatggaacttgctgtacatgctcaatttattacaactacttttaggcctgaattgctt
gagtcagctgacaaattctatggtgtaaagttcagaaacaaggttagtcatattgatgtg
atcacagcagagatggccaaagactttgtagaagatgataccactcatggttaa

DBGET integrated database retrieval system