KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511436
Entry
107511436         CDS       T06036                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2 isoform X1
  KO
K03099  son of sevenless
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04062  Chemokine signaling pathway
ray04068  FoxO signaling pathway
ray04072  Phospholipase D signaling pathway
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04714  Thermogenesis
ray04722  Neurotrophin signaling pathway
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04926  Relaxin signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05034  Alcoholism
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107511436 (SOS2)
   04012 ErbB signaling pathway
    107511436 (SOS2)
   04014 Ras signaling pathway
    107511436 (SOS2)
   04630 JAK-STAT signaling pathway
    107511436 (SOS2)
   04068 FoxO signaling pathway
    107511436 (SOS2)
   04072 Phospholipase D signaling pathway
    107511436 (SOS2)
   04151 PI3K-Akt signaling pathway
    107511436 (SOS2)
   04150 mTOR signaling pathway
    107511436 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107511436 (SOS2)
   04540 Gap junction
    107511436 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107511436 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107511436 (SOS2)
   04660 T cell receptor signaling pathway
    107511436 (SOS2)
   04662 B cell receptor signaling pathway
    107511436 (SOS2)
   04664 Fc epsilon RI signaling pathway
    107511436 (SOS2)
   04062 Chemokine signaling pathway
    107511436 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107511436 (SOS2)
   04912 GnRH signaling pathway
    107511436 (SOS2)
   04915 Estrogen signaling pathway
    107511436 (SOS2)
   04917 Prolactin signaling pathway
    107511436 (SOS2)
   04926 Relaxin signaling pathway
    107511436 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    107511436 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107511436 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    107511436 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511436 (SOS2)
   05206 MicroRNAs in cancer
    107511436 (SOS2)
   05205 Proteoglycans in cancer
    107511436 (SOS2)
   05231 Choline metabolism in cancer
    107511436 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107511436 (SOS2)
   05225 Hepatocellular carcinoma
    107511436 (SOS2)
   05226 Gastric cancer
    107511436 (SOS2)
   05214 Glioma
    107511436 (SOS2)
   05221 Acute myeloid leukemia
    107511436 (SOS2)
   05220 Chronic myeloid leukemia
    107511436 (SOS2)
   05211 Renal cell carcinoma
    107511436 (SOS2)
   05215 Prostate cancer
    107511436 (SOS2)
   05213 Endometrial cancer
    107511436 (SOS2)
   05224 Breast cancer
    107511436 (SOS2)
   05223 Non-small cell lung cancer
    107511436 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    107511436 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107511436 (SOS2)
   05160 Hepatitis C
    107511436 (SOS2)
   05163 Human cytomegalovirus infection
    107511436 (SOS2)
   05165 Human papillomavirus infection
    107511436 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107511436 (SOS2)
   01522 Endocrine resistance
    107511436 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107511436 (SOS2)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107511436 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH PH_19 PH_13 PH_10
Other DBs
NCBI-GeneID: 107511436
NCBI-ProteinID: XP_016001254
LinkDB
Position
Unknown
AA seq 1332 aa
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPSLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPTSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDKKLFKPSDI
EKIFSNISDIHELTIKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQAIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALMNLQGSMDRIYKQYAPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCEYKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIRRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPAPTGAFDGPL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHLHRDPDWFRDVSTSPNSPN
TPPSTPSPRVPRRSYVLNSSQNNLAHPQAPPVPPRQTSSPHLPKLPPKTYKRELSHPPLY
RLPLLENAETPQ
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccgtacgagttcttcagcgaagagaacagtccgaaatggcgg
ggactgttagtctcggccctgcggaaggttcaggagcaagtacatcccagtctctcagct
aatgaagaatctctgtattatattgaagagctgatttttcagctgcttaataaattatgc
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaaaacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgctatagagaaacgcaaacgaaga
aatcctctcttgttgcctgtggacaaaatccatccttcactgaaggaagttttagggtac
aaagtggactaccatgtgtctttatatattgtggctgtactagagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatattcgacattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggtttggtttctctttgtgaagatgaacctacttcttcaggtgaattaaactactat
gatcttgtcagaactgaaattgcagaagaaagacagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagcctttctttctgacaaaaagctgtttaagccttctgacatt
gaaaagattttcagtaatatctcggatatacacgagttgactataaaacttttaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatcccttagctggcagctgt
tttgaagatttggcagaagagcaagcatttgatccttatgaaacattatcacaggacatt
ctttcacctaaatttaatgaacatttcagtaagttgatggccagacctgcagtggctctt
cactttcaggccattgctgatggttttaaagaagcagttcgttatgtccttccacgcctt
atgctggtgccagtgtatcactgttggcactattttgaattattgaagcaattgaaagca
tgtagtgaagaacaagaagacagagaatgtttgaaccaagctattactgctctcatgaat
ctccaaggtagtatggaccgaatttacaagcagtatgcaccacgacgccgacctggggat
cctgtttgccctttttataatcgccaattaagaagcaagcatctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaat
gaattcattatggaaggtccattgacaagaattggtgctaaacatgaacggcatattttt
ctctttgatggcttaatgattagctgcaaacccaatcatagccagtcacgccttccaggt
tacagtagtgcagaatacagattaaaagaaaaatttgttatgaggaaaatacaaatatgt
gataaagaagatacttgtgagtacaaacatgcttttgagttagtatccaaagatgaaaac
agtataatatttgcagctaagtctgctgaagagaaaaacaattggatggcagcacttatt
tctcttcattatcgtagtactctagatcgaatgctagattcagtattattgaaagaagaa
aatgaacaacctttgagattaccaagtcctgaagtatatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacttgcaaagtagaagtggaatccccattattaaa
ggaggaactgtggtgaaattaattgaaagattaacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttactacatatcgttcattttgtaaaccacaggaattgctaagc
ttactaattgaacgatttgaaattccggagccggaacctactgaagcagataaattggct
gtagagaaaggcgagcagccaattagtgcagaccttaaaaggtttcgcaaggaatacgtc
caaccagtacaacttagaatcttaaatgtttttcggcactgggttgaacaccatttttat
gactttgaaagagatttggagttgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagccatgaagaaatgggtagagtccattgctaagatcatcaggaggaagaaacaa
gctcaggcaaatggaataagccacaatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcagaccaggacagtttgaaacatttgatcttatgacacttcatccaata
gaaattgcacgtcagctgacacttttggaatctgatctttacaggaaagtacaaccttct
gaacttgtaggaagtgtatggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccacactacaaatcttacgctctggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgagtggcagtactgagtagaattatagaaattctgcaagtcttt
caagatttgaataatttcaatggtgttttggagatagtcagtgcagtaaattcagtgtca
gtatacagactagaccatacatttgaggcattgcaggaaagaaaaaggagaattttggat
gaagctgtggaattgagtcaagaccactttaaaaaatacctagtaaaacttaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaa
gggaataatgattttttaaaaaagaaagggaaagacttaatcaatttcagtaagaggagg
aaagtggctgaaattactggagaaattcagcagtatcagaatcaaccttattgtttacgg
atagaaccagaaatgaggcgattctttgaaaatcttaaccccatgggaagtgcttctgaa
aaagagtttacagattatttgttcaacaagtcactagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctaggaaatcaactttctctttgaaatctcctggaataaggcct
aatacaggccgacatggctctacctcaggcactttacgaggtcatccaacaccattggaa
agagaaccatgtaaaataagctttagtcggattgctgaaactgagcttgaatcaacagtg
tcagcaccgacctctccaaacacaccatctactccaccagtatctgcttcttcagacctc
agtgtgtttttagatgtggatctcaatagttcctgtggcagcaatagcatcttcgctcca
gttctcttgccacattcaaagtctttcttcagttcgtgtggtagtttacataaacttagt
gaagagccactgattcctccacctcttcctcctcgaaaaaagtttgatcatgatgcttca
aattccaagggaaatatgaaatctgatgatgacccccctgctattccaccaagacaacct
cctcctccaaaggtaaaacccagagttcctgctcctactggtgcatttgatgggcctctg
catagtccacctccaccgccgccaagagatcctcttcctgatacccctccaccagttccc
cttcggcctccagaacactttataaactgtccatttaatcttcagccacctccgctggga
catcttcacagagatccagactggttcagagatgttagtacgtctccgaattcaccaaac
actcctcctagcacaccttctccaagggtgccacgtcgaagctatgtgctcaattctagt
cagaataatcttgctcatcctcaagctccccctgttccaccaaggcagacttcaagccct
cacctcccaaaactgccaccaaagacttacaaacgggagctttcacaccccccattgtat
agactgcctttgctagaaaatgcagaaactcctcaatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519446
Entry
107519446         CDS       T06036                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04062  Chemokine signaling pathway
ray04068  FoxO signaling pathway
ray04072  Phospholipase D signaling pathway
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04714  Thermogenesis
ray04722  Neurotrophin signaling pathway
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04926  Relaxin signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05034  Alcoholism
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107519446 (SOS1)
   04012 ErbB signaling pathway
    107519446 (SOS1)
   04014 Ras signaling pathway
    107519446 (SOS1)
   04630 JAK-STAT signaling pathway
    107519446 (SOS1)
   04068 FoxO signaling pathway
    107519446 (SOS1)
   04072 Phospholipase D signaling pathway
    107519446 (SOS1)
   04151 PI3K-Akt signaling pathway
    107519446 (SOS1)
   04150 mTOR signaling pathway
    107519446 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107519446 (SOS1)
   04540 Gap junction
    107519446 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107519446 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107519446 (SOS1)
   04660 T cell receptor signaling pathway
    107519446 (SOS1)
   04662 B cell receptor signaling pathway
    107519446 (SOS1)
   04664 Fc epsilon RI signaling pathway
    107519446 (SOS1)
   04062 Chemokine signaling pathway
    107519446 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107519446 (SOS1)
   04912 GnRH signaling pathway
    107519446 (SOS1)
   04915 Estrogen signaling pathway
    107519446 (SOS1)
   04917 Prolactin signaling pathway
    107519446 (SOS1)
   04926 Relaxin signaling pathway
    107519446 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    107519446 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107519446 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107519446 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519446 (SOS1)
   05206 MicroRNAs in cancer
    107519446 (SOS1)
   05205 Proteoglycans in cancer
    107519446 (SOS1)
   05231 Choline metabolism in cancer
    107519446 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107519446 (SOS1)
   05225 Hepatocellular carcinoma
    107519446 (SOS1)
   05226 Gastric cancer
    107519446 (SOS1)
   05214 Glioma
    107519446 (SOS1)
   05221 Acute myeloid leukemia
    107519446 (SOS1)
   05220 Chronic myeloid leukemia
    107519446 (SOS1)
   05211 Renal cell carcinoma
    107519446 (SOS1)
   05215 Prostate cancer
    107519446 (SOS1)
   05213 Endometrial cancer
    107519446 (SOS1)
   05224 Breast cancer
    107519446 (SOS1)
   05223 Non-small cell lung cancer
    107519446 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    107519446 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107519446 (SOS1)
   05160 Hepatitis C
    107519446 (SOS1)
   05163 Human cytomegalovirus infection
    107519446 (SOS1)
   05165 Human papillomavirus infection
    107519446 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107519446 (SOS1)
   01522 Endocrine resistance
    107519446 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107519446 (SOS1)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107519446 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 107519446
NCBI-ProteinID: XP_016017653
LinkDB
Position
Unknown
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITEQDIKVAMCADKVLMDMFHQDV
EDINIFYLTDEEPSTSGEQTYYDLVKSFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFEFLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTQSHGPRSASVSSISL
TKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSVSDAPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcgcccaagtggcgg
gggctgctagtgcctgcgctgaaaaaggtccagggacaagttcatcctactcttgagtct
agtgatgatgctcttcagtatgttgaagaattaatcttgcaactattaaatatgctatgc
caagctcagccccgaagtgcttcagatgtagaggaacgagttcaaaaaagttttcctcat
ccaattgataaatgggcaatagctgatgcccaatcggctattgaaaagaggaaacgaaga
aatcctttatctctcccagtagaaaaaattcatcctttattaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttctgcagac
attttaaagctggtggggaattacgtacgaaatatacggcattatgaaattacagaacaa
gatattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatatattttatttaactgatgaagagccttccacctcaggagagcaaact
tactatgatttggtaaaatcatttatggcagaaattcgacaatacataagggaactaaat
ttaattataaaagtttttagagagccttttgtctccaattcaaaattgttttcagctaac
gatgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgtaaagttactg
ggccatatagaagatactgtagaaatgactgatgaaggcagtccccatccattagtagga
agctgctttgaagacttagcagaagaattggcatttgatccatatgaatcatatgctcga
gatattttacgacctggttttcatgatcgttttcttagtcagttatcaaagcctggagca
gcactttatttgcagtcaataggcgaaggtttcaaggaagctgttcaatatgttttaccc
aggctgcttctagccccggtttaccactgtctacattactttgaatttttgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaataacagctttg
cttaatgttcaaagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaatgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgaatttataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagtaatgcagaatatcgtcttaaagaaaagttttttatgagaaaggtacaa
attaatgacaaagatgacaccagtgaatacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ttgatatctttacagtaccgaagtacactggaaaggatgcttgatgtgacaatgctacag
gaagagaaggaggagcagatgaggctccctagtgctgatgtttatagatttgcagagcct
gactctgaagagaacataatatttgaagaaaacatgcagcccaaggctggaattccaatt
atcaaagcaggaactgttattaaactgatagagaggctcacataccatatgtacgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
attgctattgagaatggagatcaacccttgagtgcagaactaaaaagatttagaaaagaa
tatatacagcctgtacaactgcgagtattaaacgtatgtcggcactgggttgagcatcac
ttctacgattttgaaagagatgcagatcttttgcagcgaatggaggaatttattgggaca
gtaagaggtaaagcaatgaaaaaatgggtcgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcacctcccaca
gttgagtggcatataagcagacctgggcacatagagacttttgatctgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctatatcgagctgtacag
ccatcggaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
cttctgaaaatgatccggcacaccactaatctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgaaattctgcaa
gtctttcaagagctgaacaacttcaatggtgtccttgaggttgtcagtgctatgaactca
tcacctgtttacaggctagaccacacgtttgagcaaataccaagtcgtcaaaagaaaatt
ttagaagaagctcatgaattaagcgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctaactaatatcttgaaaaca
gaagaaggcaaccctgaggttctaaaaaggcatggaaaagagcttataaactttagtaaa
aggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcagccttattgt
ttacgagtggaatcagatatcaaaaggttctttgaaaacttgaacccaatgggaaatagc
atggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagccactcccaagatttccaaaaaaatatagctatcccttaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtaccatgagacatcctacacctctgcagcaggagcca
aggaaaattagttatagtcggatccctgaaagtgagacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttccggtgcttctagtaccacagat
gtttgcagcgtatttgattctgatcattcaagcccttttcactcaagcagcgataccgtc
tttatccaagttacacagtcccatggcccaagatctgcttcagtatcatctataagttta
accaagggcactgatgaagtgcctgtcccccctcctgttcctccacgaagacgaccagaa
tctgccccagcggaatcatcgccatctaagattatgtctaagcatttggacagcccccca
gcaattcctcctaggcaacccacatcaaaagcctattcaccacgatactcaatatcagac
cggacctctgtatcagatgctcctgaaagccctcccttgttaccaccacgagaacctgtg
aggacacctgatgttttctcaagctcaccactacatctccagcctccccctttgggcaaa
aaaagtgatcacggcaatgccttcttcccaaacagcccttcgcccttcacgccacctcct
cctcaaacaccttctcctcatggcacgagaaggcatctgccatcaccaccgttgacacaa
gaagtggaccttcattccattgctgggccacctgttcctccacgacaaagcacttctcaa
catattcctaaactccctccaaaaacttacaaaagggagcacacacacccatccatgcac
agagatggaccaccactgttggagaatgcccattcttcctga

DBGET integrated database retrieval system