KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511488
Entry
107511488         CDS       T06036                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform isoform X1
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00562  Inositol phosphate metabolism
ray01100  Metabolic pathways
ray04022  cGMP-PKG signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04371  Apelin signaling pathway
ray04611  Platelet activation
ray04725  Cholinergic synapse
ray04921  Oxytocin signaling pathway
ray05132  Salmonella infection
ray05145  Toxoplasmosis
ray05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107511488 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107511488 (PIK3CG)
   04072 Phospholipase D signaling pathway
    107511488 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    107511488 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    107511488 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107511488 (PIK3CG)
   04062 Chemokine signaling pathway
    107511488 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107511488 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107511488 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    107511488 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107511488 (PIK3CG)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107511488 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107511488 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107511488 (PIK3CG)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107511488 (PIK3CG)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107511488 (PIK3CG)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 Myc-LZ
Other DBs
NCBI-GeneID: 107511488
NCBI-ProteinID: XP_016001351
LinkDB
Position
Unknown
AA seq 1130 aa
MSLFHCLVQPTCVDIHEVPAIVLQVAEGMELENDEQLVVLREDNCRRRRRMKPRGPAASL
SSMELVPIEFVLPTRQRTSKTPEIVLLHVAGHGNVEQMKAQVWLRALETSVVADFYHRLG
PDNFLLLYQKKGQWYEIYDKYQVVQTLDCLCYWKVLHRSPGQIHVVQRHSPSEETLAFQR
QLTALMGYDVTDVSNVHDDELEFTRRRLVTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLS
KKITNNCIFIVIHRSTTSQTIKVSADDTPGAILQSFFTKMAKKKSLMDIPESQNEQDFVL
RVCGRDEYLVGETPIKNFQWVRHCLKNGEEIHLVLDTPPDPAQDEVRKEEWPLVDDCTGV
TGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNSDLTVFVEANIQHGQQ
VLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPVLSSKGPAEIPSS
ESKSKSQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKEN
SMSISILLDNYCHPIALPKHRPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDK
ELLWHFRYESLKHPKAYPKLFSSVKWGEQEIVAKTYQLLAKREVWDQSALDVGLTMQLLD
CNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIG
HFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQRVTIDIKSL
SAEKYDVSSQVISQLKQKLENLQNSNLPKSFRVPYDPGLKAGTLVVEKCKVMASKKKPLW
LEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIST
GDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKCPIEEKFQAAVERFVYSC
AGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFL
FVMGTSGKKSSLHFQKFQDICAKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIR
DALTVGKNEDDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgtctctgtttcattgtctagttcaacctacatgtgtggatattcacgaggttccggca
atagttttgcaggtcgcagagggcatggagctggagaacgatgaacagctggtggttctg
agagaggacaactgccgcagacgccggaggatgaagccgcgtggccccgctgctagcctg
tcctccatggagctcgtccccatcgagttcgtgctgcccaccaggcagcgcaccagcaaa
accccggaaatagtgctgctgcacgtggcgggccacggcaatgtggagcaaatgaaggcg
caggtgtggctgcgtgcactggagaccagtgtggtggctgacttctaccaccggcttggc
ccagacaacttcctactgctctaccagaagaagggacagtggtacgagatctacgacaag
taccaagtggtacagactctggactgtctatgctactggaaggtgctgcacaggagcccg
ggccagatccatgttgtgcagcggcactcgccctctgaggagacgctagctttccagcgg
cagcttacagccctcatgggctatgatgtcacggacgtcagcaacgtgcacgatgatgag
ctcgaattcacacgccgccgcctggtcaccccgcggatggctgaggtggccggccgtgac
cctaaactctatgccatgcacccctgggtgacctccaagcccctcccggagtacctgtcg
aagaagattaccaacaactgcatcttcattgtcattcaccgtagcaccaccagccagacc
atcaaggtctcagctgacgacaccccaggcgctatcctccagagcttctttaccaagatg
gccaaaaagaagtctctgatggatatccctgaaagccaaaatgaacaggactttgtgctg
cgtgtctgtggccgggatgagtacctggtgggtgaaacacccatcaaaaattttcaatgg
gtgaggcattgcctcaagaatggggaagagattcacctggtgcttgacactcctccggac
ccagcccaggacgaggtgagaaaagaagagtggccactggtggatgactgcactggagtc
accggctaccatgaacagctgactatccacgggaaggaccatgagagtgtgttcaccgtg
tctttgtgggactgtgaccggaagttcagggtcaaaatcagaggcattgatattcctgtc
ctgccccggaattctgacctcactgtttttgtagaggcaaacatccagcatgggcagcag
gtcctttgccagaggaggaccagccccaaacccttcacagaggaggtgctctggaatgtg
tggcttgagttcagtatcaaaatcaaagatttacccaaaggggcgctactgaacctccag
atctactgtggaaaagctccagtgttgtccagcaagggccctgctgagattccaagttct
gagtccaaaagcaaatctcagcttctctattatgtgaacctgctgctgatagaccaccgg
ttcctcttgcgccgtggggaatatgtgctgcacatgtggcagatatctgggaaaggagaa
gaccaagggagcttcaatgctgacaagctaacgtctgcaaccaacccagacaaggagaac
tcaatgtccatatccattcttctggacaattactgtcatccaatagccttgcctaagcat
aggcccacccctgaccctgagggggaccgggttcgagccgaaatgcccaaccagcttcgg
aagcaactggaagcaatcatagccactgatccacttaaccctctcacagcagaagacaaa
gaattactctggcattttagatacgaaagcctcaagcatccaaaagcatatcctaagcta
tttagctcagtgaaatggggagagcaagaaattgtggccaaaacataccaactgttagcc
aaaagggaggtctgggatcaaagtgctttggatgtcgggctaacaatgcaactcctggac
tgcaacttttcggatgaaaatgtaagagccattgcagttcagaaactggagagcttggaa
gacgatgatgttttgcattacctgctacagctggtccaggctgtgaaatttgaaccttac
catgacagtgcccttgccagatttctgctgaagcgtggtttaagaaacaaaagaattggt
cacttcttgttttggttcttgagaagtgagatagcccagtccaggcactaccagcagagg
ttcgctgtgatcctagaagcctacttgaggggctgtggcacggccatgttgcacgacttt
acccaacaagtccaagtaatcgagatgttacaaagagtcaccattgatattaaatcactc
tctgctgaaaagtatgatgtcagttcccaagttatttcacaacttaaacaaaagcttgaa
aacctacagaattcgaatctcccaaagagctttagagttccgtatgatcctggactgaaa
gcaggaacactggtggttgaaaaatgtaaagtaatggcctccaagaagaagcccctgtgg
cttgaatttaaatgtgctgaccctacagctctatcgaatgaaacaattggaattatcttt
aaacacggtgatgatctacgccaagacatgcttatattacagattctacgaatcatggag
tccatttgggagactgaatctttggatctgtgcctcctgccatatggttgcatttcaact
ggtgacaaaataggaatgatcgagattgtgaaagatgccacgacaattgccaaaattcag
caaagcacagtaggcaacacaggcgcatttaaggatgaggtcctgaatcactggcttaaa
gaaaaatgccctattgaagaaaagtttcaggcagcagtagagagattcgtttactcctgt
gctggctactgtgtggcaacctttgttcttggaataggtgaccggcacaacgacaacatt
atgatcacagagactggaaatctatttcatatagactttgggcacattcttggcaattac
aaaagtttcctgggcattaataaagagagagtgccatttgtgctaaccccagacttcctg
tttgtgatgggaacttctggaaagaagtcaagcctacacttccagaaatttcaggacatc
tgtgctaaggcttatctagcccttcgtcatcatacaaacctactgatcatcctgttctcc
atgatgctgatgacgggaatgccacagttaacaagcaaagaagacattgaatatattagg
gatgccctaacagtggggaaaaacgaggacgatgctaaaaagtattttcttgatcagatt
gaagtttgcagagacaagggatggactgtgcaatttaattggttcctacatcttgtcctt
ggcatcaaacaaggagagaaacattcagcctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515658
Entry
107515658         CDS       T06036                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04371  Apelin signaling pathway
ray04611  Platelet activation
ray04725  Cholinergic synapse
ray04921  Oxytocin signaling pathway
ray05145  Toxoplasmosis
ray05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107515658 (PIK3R5)
   04072 Phospholipase D signaling pathway
    107515658 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    107515658 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    107515658 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107515658 (PIK3R5)
   04062 Chemokine signaling pathway
    107515658 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107515658 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107515658 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    107515658 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107515658 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107515658 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107515658 (PIK3R5)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107515658 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101 DUF2284
Other DBs
NCBI-GeneID: 107515658
NCBI-ProteinID: XP_016010158
LinkDB
Position
Unknown
AA seq 877 aa
MQPGATTCTEDRIRHALERCLHGLNFNRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEQGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAARTYHRFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLPVRSHRSSTVTVLLLNPVEVQAEFLAVAN
KLSTPGHTPHSAYITLLLHAFQATFGTNCDLPGLHRRLQSKTLAELEDIFTETAEAQELA
SGIGDAAEARRWLRTKLQAVGEKAGFRGVLDTAKPGKLHTIPIPVARCYTYDWNQDSFDI
LQEILLKEQDLLQPGILGDDEEEEEEEEEDLETDGHCAKRDSLLSTSSEAFHDSSLSLAS
SQASGATLSRQLLTSFVSGLSDGMDSGYMEDSEESSPEWPKRPGSRERRGYRRPGQKFNR
IYKLFKSTSQLVMRRDSRGLEGSSDTTLPLRRAGSLCSPLDTPALPPARAQRSLSLPQPK
LSAQLPSWLLAPASRHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRRLEN
NRPLLTRFFKLQFFYVPVKRSQGTSSNTCPTSRSQTPPLSTDSPKHPSSAELGTAPWEES
TNDISYYLGMLDPWYERNVLGLMHLPPEVLCQQSLKADSRPLEGSLTQLPILADMLLYYC
RFAARPVLLQVYQTELTFITGEKKTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDRE
AVPLTLQIIYSKGAISGRSRWSNIEKVCTSINLNKACRRQEELDASMEALTLNLTEVVKR
QNPKSKKGFNQISTSQIKVNKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYKPEK
STLCTQPQRSPDPAVQAAPDLCSLLCLPIMTFSGALP
NT seq 2634 nt   +upstreamnt  +downstreamnt
atgcagccaggagccacaacatgcacagaggaccgcatcaggcatgccctggagcgctgc
ttgcacgggctcaacttcaaccgccgttccacctcctggtcagctgggctatgtctgaac
tgctggagcctacaggagctggtcagcagggatccgggccatttccttatcctcctggaa
cagatcttgcagaaaacccgagaggtccaagagcagggtacctatgacctccttgcgccc
ctggccctgctcttctactccactgtcctctgtactccacactttccgccagactcagat
ctccttctgaaagcagccagaacctaccaccgattcctgacctggcctgttccctactgc
agcatctgccaggaactgctcaccttcatcgatgctgaactcaaggccccaggaatctcc
taccagagactggtgagggctgagcagggcctgcccgttaggagtcaccgaagctccact
gtcactgttctattgctgaacccagtggaagtgcaggctgagttcctcgccgtagccaac
aagctgagcacgcccgggcacacgccccacagcgcctacatcaccctgctcctgcacgcc
ttccaggccacctttgggaccaactgtgacctccccggtctgcaccgtaggctgcagtcc
aagaccctggcagagcttgaggacattttcacggagactgcagaggcacaggagctggcg
tctggcatcggggatgcagccgaggcccggcggtggctcaggaccaagctgcaggcagtg
ggagagaaagctggcttccgtggtgtcttagacactgcaaaacccggcaagctccacacc
atccccatccctgtcgccaggtgctatacttacgactggaaccaggacagctttgacatc
ttacaggaaatcctgctcaaggaacaggacctgctccagccagggatcctgggggatgat
gaggaagaggaagaggaggaggaggaggacttggaaacagacgggcattgtgccaagaga
gactcactgctttctactagctcagaggccttccacgactcctccctgtcccttgcctca
tctcaggcctctggggccaccctctcccgccagttgctgacctcctttgtctcaggcctc
tcggatggcatggacagtggctacatggaagacagtgaggagagctccccggagtggcct
aagaggcctggtagtcgggaacgccggggctaccgcaggcctgggcagaagtttaacagg
atctataaactcttcaagagcaccagccagctagtaatgcggagggactctcggggcctg
gaaggcagctcggacacgaccctgcccctgaggcgggctgggagcctctgcagccccctg
gacaccccagcactgccccctgcccgggcccagcgctccctctccctgccccagcccaag
ctcagcgcccaactgcccagttggctcctggcccctgcctctcgccatcagcgccgccgc
cccttcctgagtggggatgaggaccccaaggcttccacactacgtgttgtggtcttcggc
tccgatcggatttcggggaaggtggctcgggcatacagcaacctgcggcggctggagaac
aaccgcccgctcctcacacggttcttcaagcttcagttcttctatgttcctgtgaagcga
agccaggggaccagctctaacacctgcccaacctctcggagccagacacccccactttcc
acagactccccgaagcaccccagctctgcagagctgggcacggccccatgggaggagagt
accaatgacatttcctactacctcggcatgctcgacccctggtatgagcgtaatgtgctg
ggcctcatgcacctgccccctgaagtcttgtgccagcagtccctgaaggccgactcccgg
cccctggagggctccctcacccagctgcccatcctggccgacatgctgctctattactgc
cgcttcgctgcacggccggtgctgctgcaggtctatcagacagagctgacctttatcact
ggggagaagaagacagagatcttcattcattccctggaactgggtcactctgctgccact
cgtgccatcaaggcttcaggtcctggcagcaagaggctgggcattgatggggaccgggag
gccgtccctttaacactacagataatttacagcaagggggccatcagtggacgaagtcgc
tggagtaacattgagaaggtctgtacctccatcaacctcaacaaagcctgccggaggcag
gaggaactagatgccagcatggaggccctgacgctaaacctgacagaagtggtgaaaagg
caaaacccgaaatccaagaagggctttaaccagatcagcacatcgcagatcaaagtgaac
aaggtacagattattggatccaacagctgcccctttgccgtgtgtctggaccaggatgag
aggaaaatcctccagagtgtggtcaggtgtgaggtctcaccttgctacaagccagagaag
agcaccctctgcacccaaccccagaggtcccccgacccagccgtccaggctgcccctgac
ctctgctccctcctctgcctgcccatcatgactttcagtggagctctaccttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515659
Entry
107515659         CDS       T06036                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04371  Apelin signaling pathway
ray04611  Platelet activation
ray04725  Cholinergic synapse
ray04921  Oxytocin signaling pathway
ray05145  Toxoplasmosis
ray05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107515659 (PIK3R6)
   04072 Phospholipase D signaling pathway
    107515659 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    107515659 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    107515659 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107515659 (PIK3R6)
   04062 Chemokine signaling pathway
    107515659 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107515659 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107515659 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    107515659 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    107515659 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107515659 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107515659 (PIK3R6)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107515659 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 107515659
NCBI-ProteinID: XP_016010168
LinkDB
Position
Unknown
AA seq 747 aa
MESSDVELDLQRSVQAVLRELSAQAPALQRNQGMWRWSLHKKVERDPGKSPTLVRILLRE
LEKAEREDERHVIIPLLHTLMYVLTKATGITEELYRRTYAFCMRLLTLPTPYCTVALDCA
IRLKTEQAVPGTLYQRLVIAEQNLRSELYPYQERVFLFVDPELVAPSVCSALLLEIEAAQ
VQQTPEACMRYVVSHALQAALGEACHTSALQRKLQASPRHALEHYFHAVVAATEQMASEP
SPSREGHLERLEEIYCSLLGPAAAARGRCSSDPLPDRPPSIPLPSPHITFHLWTDEEQLW
KELVLFLCPQSQVRLSADLEALDLWGFQPDRMLARASVLSTDSGIERDIPLGPDELPTPS
SPEMEHAGLQRKGGIKKRVWPPDILMPGSWDGPLGLHRRTGRPSGDWGLLPGVSRLHTAR
VLVLGDDRMLGRLAQAYHSLRKRETQTFCLTPRLSLQLYYIPVLTPEKLASSRHLELGEL
AAFLGRADPWYESTINTLCPAIHKLAEMVGAAKPPSLGRSQTVDPFILDVITYYVRMGTQ
PIYFQIYTVKIFFSDLSQDSAEDIFLTELKVKIQDSKFPKDGFSPRRRGMTEGPGAELSI
CYQKALLSHRTQEVTVSLRATGLVLKALPASDTEDHMCLNVSVIEVVKSSNLAGRSFSTV
TNTFRTASIRIQSQDQRLLTLLLDKDNRRTFRDVIRFEVVPCPEPCSGIQKSKALWLSSH
QQKEMERTKAKPKPLLMPINTFSGIVQ
NT seq 2244 nt   +upstreamnt  +downstreamnt
atggagagctcagatgtggagttggacctccagcggagcgtgcaggccgtgctccgggag
ctcagcgcccaggccccggccctgcagaggaaccaaggtatgtggagatggtccctgcac
aagaaggtcgagcgagatcctggtaagagtccgacgctggtccgaattctgctcagagaa
ctggagaaggcagaaagggaggacgaacggcatgtcatcattcccttgctgcacactcta
atgtatgtactcacaaaggccacgggcatcacagaggagctctaccgaaggacttacgcc
ttttgcatgaggttactgaccctgcccaccccctactgcacggtggctctggattgcgcc
ataaggctgaaaacagagcaagctgtcccaggaacactgtaccagaggctggtcattgcc
gagcagaacttaaggagtgaactgtatccctaccaggagagagtgttcctctttgtggat
cctgagctggtagctccctcggtgtgcagtgccctgctgctggagatcgaggcagcccag
gtgcagcagacacctgaggcctgcatgcgctatgtggtgtcccatgccctgcaggcggct
ctgggggaggcctgccacacaagtgctctgcaaaggaagctgcaggccagcccccgccac
gccctggagcactatttccatgcggtggtggcagccactgagcagatggctagcgagccc
agcccgagccgggaaggacacctggaaaggctggaagagatttactgctcgctgctgggg
ccggcggcggccgccaggggacgctgcagcagtgacccccttccagaccggccaccaagc
atccctctgcccagcccacacatcaccttccacctgtggacggatgaggagcagctctgg
aaggaactggttctcttcctgtgcccgcaatcccaagtgcgcctcagcgctgacttggag
gccttggatctgtggggctttcagccggacaggatgctggcccgggcgtccgtgctgtcc
actgacagtggcatcgagcgggacattcctttgggacctgacgagctgcccacgcccagc
agtcctgagatggagcatgctgggctgcaacgaaaagggggcatcaagaagcgggtgtgg
ccccctgacatcttgatgccaggcagctgggatgggcccctggggctgcaccggagaaca
ggcaggcccagtggggattggggactgctgcccggcgtctcccgcctgcacacggctcgg
gtgctagtgctgggggacgacaggatgctggggcgcctggcccaggcctaccacagcctc
aggaaacgagagacccagaccttctgcctcactcccagactcagcctgcagctctattac
atccctgtgctgacacctgagaagctcgcatcatccaggcatttggagctcggagagctg
gcagcgttcctgggccgtgcggacccatggtatgagagtaccatcaacaccctgtgccca
gccatccacaagctcgcagaaatggtaggggcagcaaagcctccctccctgggcagatcc
caaactgtagaccccttcatcctggatgtcatcacctactacgttcgcatgggcactcaa
cctatctatttccaaatctatacagtaaagatcttctttagtgacctaagccaagactct
gcagaggacatttttctcactgagctaaaggtgaagatccaagactccaaattccccaaa
gatggtttctcacccaggaggagaggcatgacggaaggcccaggggctgagctctccatt
tgctaccagaaggccctgctcagccaccggacccaagaagtcaccgtttcgctgcgtgcc
actggtctggtcctgaaggcccttccagccagtgacactgaagaccacatgtgcctgaat
gtcagtgtgatagaggttgtcaagtcatccaacctggctggaaggtccttctctacggtg
acaaacaccttccggacagccagcattcggatccagagccaggaccagaggctgctgaca
ctgctgctagacaaagacaatcggcgtactttcagggatgtgatcaggtttgaggttgtt
ccctgcccggagccatgttctgggatccagaagtctaaggcactttggctcagttcacac
cagcagaaggaaatggaaaggaccaaagccaagcccaaaccccttctaatgcccatcaac
acattctcaggcatcgtccagtga

DBGET integrated database retrieval system