KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511590
Entry
107511590         CDS       T06036                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04114  Oocyte meiosis
ray04140  Autophagy - animal
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04340  Hedgehog signaling pathway
ray04371  Apelin signaling pathway
ray04530  Tight junction
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04740  Olfactory transduction
ray04742  Taste transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04910  Insulin signaling pathway
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04962  Vasopressin-regulated water reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04976  Bile secretion
ray05012  Parkinson disease
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05032  Morphine addiction
ray05034  Alcoholism
ray05146  Amoebiasis
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107511590 (PRKACB)
   04014 Ras signaling pathway
    107511590 (PRKACB)
   04310 Wnt signaling pathway
    107511590 (PRKACB)
   04340 Hedgehog signaling pathway
    107511590 (PRKACB)
   04371 Apelin signaling pathway
    107511590 (PRKACB)
   04020 Calcium signaling pathway
    107511590 (PRKACB)
   04024 cAMP signaling pathway
    107511590 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107511590 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107511590 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107511590 (PRKACB)
   04540 Gap junction
    107511590 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107511590 (PRKACB)
   04062 Chemokine signaling pathway
    107511590 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    107511590 (PRKACB)
   04910 Insulin signaling pathway
    107511590 (PRKACB)
   04922 Glucagon signaling pathway
    107511590 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    107511590 (PRKACB)
   04912 GnRH signaling pathway
    107511590 (PRKACB)
   04913 Ovarian steroidogenesis
    107511590 (PRKACB)
   04915 Estrogen signaling pathway
    107511590 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    107511590 (PRKACB)
   04921 Oxytocin signaling pathway
    107511590 (PRKACB)
   04926 Relaxin signaling pathway
    107511590 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    107511590 (PRKACB)
   04918 Thyroid hormone synthesis
    107511590 (PRKACB)
   04919 Thyroid hormone signaling pathway
    107511590 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    107511590 (PRKACB)
   04916 Melanogenesis
    107511590 (PRKACB)
   04924 Renin secretion
    107511590 (PRKACB)
   04925 Aldosterone synthesis and secretion
    107511590 (PRKACB)
   04927 Cortisol synthesis and secretion
    107511590 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107511590 (PRKACB)
   04270 Vascular smooth muscle contraction
    107511590 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    107511590 (PRKACB)
   04971 Gastric acid secretion
    107511590 (PRKACB)
   04976 Bile secretion
    107511590 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107511590 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107511590 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    107511590 (PRKACB)
   04727 GABAergic synapse
    107511590 (PRKACB)
   04725 Cholinergic synapse
    107511590 (PRKACB)
   04728 Dopaminergic synapse
    107511590 (PRKACB)
   04726 Serotonergic synapse
    107511590 (PRKACB)
   04720 Long-term potentiation
    107511590 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    107511590 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    107511590 (PRKACB)
   04742 Taste transduction
    107511590 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    107511590 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    107511590 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    107511590 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107511590 (PRKACB)
   04714 Thermogenesis
    107511590 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511590 (PRKACB)
   05205 Proteoglycans in cancer
    107511590 (PRKACB)
   05203 Viral carcinogenesis
    107511590 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107511590 (PRKACB)
   05020 Prion disease
    107511590 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    107511590 (PRKACB)
   05031 Amphetamine addiction
    107511590 (PRKACB)
   05032 Morphine addiction
    107511590 (PRKACB)
   05034 Alcoholism
    107511590 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107511590 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107511590 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107511590 (PRKACB)
   05163 Human cytomegalovirus infection
    107511590 (PRKACB)
   05165 Human papillomavirus infection
    107511590 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107511590 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107511590 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107511590 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107511590 (PRKACB)
   03036 Chromosome and associated proteins [BR:ray03036]
    107511590 (PRKACB)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107511590 (PRKACB)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKA family
   107511590 (PRKACB)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107511590 (PRKACB)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107511590 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107511590
NCBI-ProteinID: XP_016001575
LinkDB
Position
Unknown
AA seq 397 aa
MAAYRELSSNQCTGTTALQKLEGFASRLFHRHSKGTTHDQKTALENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFSEF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagcttatagagaactatccagtaaccagtgtacaggtacaactgctcttcagaag
ttggaaggttttgctagccgattatttcatagacactctaaaggtactacacatgatcag
aaaacagctctggaaaatgacagccttcatttctctgaacatactgcgttatgggacaga
tcaatgaaagagtttctagctaaagccaaagaagactttttaaaaaaatgggaaaatcct
gcccagaataatgctggcttggaggattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgctggtgaagcataaagccactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaaactgaaacaaatagaacacactttgaatgagaaaaga
atattacaggcagtgaattttccttttcttgttcgactggagtattcttttaaggataat
tctaatttatatatggttatggaatatgtccctgggggtgaaatgttttcacatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcaaatagtgctgaca
ttcgagtaccttcattcactagacctcatctacagagatctaaaacctgaaaatctccta
attgaccaccaaggttatatccaggtcacagactttgggtttgccaaaagagttaaaggc
agaacttggacattgtgcggcactccagaatatttggctccagaaataatcctcagcaag
ggctacaataaggcagtggattggtgggcattaggagtattaatctatgaaatggcagct
ggctaccccccattctttgcagatcaacctattcagatttacgaaaagattgtttctgga
aaggttcgatttccatcacacttcagttccgatctcaaggaccttctaaggaacctgctg
caggtagatttgacaaagcggtttggaaatctaaagaatggtgtcagcgacataaaaact
cacaagtggtttgctacaacagattggattgctatttaccagaggaaggtcgaagctcca
ttcataccaaagtttagaggctctggggataccagcaactttgatgactatgaagaagaa
gatatccgtgtctctataacagaaaaatgtgcaaaagagtttagtgaattttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519437
Entry
107519437         CDS       T06036                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04114  Oocyte meiosis
ray04140  Autophagy - animal
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04340  Hedgehog signaling pathway
ray04371  Apelin signaling pathway
ray04530  Tight junction
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04740  Olfactory transduction
ray04742  Taste transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04910  Insulin signaling pathway
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04962  Vasopressin-regulated water reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04976  Bile secretion
ray05012  Parkinson disease
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05032  Morphine addiction
ray05034  Alcoholism
ray05146  Amoebiasis
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107519437 (PRKACA)
   04014 Ras signaling pathway
    107519437 (PRKACA)
   04310 Wnt signaling pathway
    107519437 (PRKACA)
   04340 Hedgehog signaling pathway
    107519437 (PRKACA)
   04371 Apelin signaling pathway
    107519437 (PRKACA)
   04020 Calcium signaling pathway
    107519437 (PRKACA)
   04024 cAMP signaling pathway
    107519437 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107519437 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107519437 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107519437 (PRKACA)
   04540 Gap junction
    107519437 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107519437 (PRKACA)
   04062 Chemokine signaling pathway
    107519437 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    107519437 (PRKACA)
   04910 Insulin signaling pathway
    107519437 (PRKACA)
   04922 Glucagon signaling pathway
    107519437 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    107519437 (PRKACA)
   04912 GnRH signaling pathway
    107519437 (PRKACA)
   04913 Ovarian steroidogenesis
    107519437 (PRKACA)
   04915 Estrogen signaling pathway
    107519437 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    107519437 (PRKACA)
   04921 Oxytocin signaling pathway
    107519437 (PRKACA)
   04926 Relaxin signaling pathway
    107519437 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    107519437 (PRKACA)
   04918 Thyroid hormone synthesis
    107519437 (PRKACA)
   04919 Thyroid hormone signaling pathway
    107519437 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    107519437 (PRKACA)
   04916 Melanogenesis
    107519437 (PRKACA)
   04924 Renin secretion
    107519437 (PRKACA)
   04925 Aldosterone synthesis and secretion
    107519437 (PRKACA)
   04927 Cortisol synthesis and secretion
    107519437 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107519437 (PRKACA)
   04270 Vascular smooth muscle contraction
    107519437 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    107519437 (PRKACA)
   04971 Gastric acid secretion
    107519437 (PRKACA)
   04976 Bile secretion
    107519437 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107519437 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107519437 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    107519437 (PRKACA)
   04727 GABAergic synapse
    107519437 (PRKACA)
   04725 Cholinergic synapse
    107519437 (PRKACA)
   04728 Dopaminergic synapse
    107519437 (PRKACA)
   04726 Serotonergic synapse
    107519437 (PRKACA)
   04720 Long-term potentiation
    107519437 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    107519437 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    107519437 (PRKACA)
   04742 Taste transduction
    107519437 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    107519437 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    107519437 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    107519437 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107519437 (PRKACA)
   04714 Thermogenesis
    107519437 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519437 (PRKACA)
   05205 Proteoglycans in cancer
    107519437 (PRKACA)
   05203 Viral carcinogenesis
    107519437 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107519437 (PRKACA)
   05020 Prion disease
    107519437 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    107519437 (PRKACA)
   05031 Amphetamine addiction
    107519437 (PRKACA)
   05032 Morphine addiction
    107519437 (PRKACA)
   05034 Alcoholism
    107519437 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107519437 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107519437 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107519437 (PRKACA)
   05163 Human cytomegalovirus infection
    107519437 (PRKACA)
   05165 Human papillomavirus infection
    107519437 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107519437 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107519437 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107519437 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107519437 (PRKACA)
   03036 Chromosome and associated proteins [BR:ray03036]
    107519437 (PRKACA)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107519437 (PRKACA)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKA family
   107519437 (PRKACA)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107519437 (PRKACA)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107519437 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107519437
NCBI-ProteinID: XP_016017636
LinkDB
Position
Unknown
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEFSFKDNSNLYMI
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaagagagcgtgaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaatacagcccat
ttggatcagtttgaacgaatcaagaccctcggcacaggctccttcgggcgagtgatgctg
gtgaaacacaaggagaccgggaaccacttcgccatgaagatcctggacaaacagaaggtg
gtaaagctgaaacagatcgagcacaccctgaatgagaagcgcatcctgcaggcagtcaac
tttccgttcctcgttagactcgagttctccttcaaggacaactcaaatttatacatgatc
atggagtatgtgcccggcggagaaatgttctcacacctgcggcggatcggaaggttcagc
gagccccatgcccgcttctacgccgcccagatcgtcctgaccttcgagtacctgcactcc
cttgatctcatctaccgggacctgaagccggagaaccttctcatcgaccagcagggctac
attcaggtgacagactttggttttgccaagcgtgtgaaaggccgcacctggaccttgtgt
gggacccctgagtacctggcccctgagatcatcctgagcaaaggctacaacaaggctgtg
gactggtgggccttgggggttctcatctacgagatggcagccggctacccacccttcttt
gctgaccagcccatccagatctatgagaagattgtctctgggaaggtgcggttcccgtct
cacttcagctctgacctgaaggatctgctgcggaacctactgcaagtggacctcactaag
cgcttcgggaacctcaagaatggggtcaatgacatcaagaaccacaagtggtttgccaca
actgactggatcgccatctaccagaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaactttgacgactatgaggaggaagagattcgagtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

DBGET integrated database retrieval system