KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511644
Entry
107511644         CDS       T06036                                 

Gene name
MUC5B
Definition
(RefSeq) LOW QUALITY PROTEIN: mucin-5B
  KO
K13908  mucin-5B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04657  IL-17 signaling pathway
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107511644 (MUC5B)
  09154 Digestive system
   04970 Salivary secretion
    107511644 (MUC5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107511644 (MUC5B)
Membrane trafficking [BR:ray04131]
 Others
  Mucins
   Secretory mucins
    107511644 (MUC5B)
SSDB
Motif
Pfam: Mucin2_WxxW VWD C8 TIL VWC
Other DBs
NCBI-GeneID: 107511644
NCBI-ProteinID: XP_016001677
LinkDB
Position
Unknown
AA seq 4943 aa
MGTPSGCQLLVWALLALLSLQKAATGGQGLFMGLPPYFTETCHWGPIQLSDVSGFFPTPT
PVPAETQGSTEPSLASTEAAANSRRADTAQRVTFIPPVATYPTMSTSNAAHNGRVCSTWG
DSHYKTFDGDVFRFPGRCNYVFSAHCGAAYEDFNIQLRRGLAGSRPTITHIVLKSQGLVL
EVSNGSVLIDGRREELPYSRAGLLVEQSSDYTKVNVRLMLTFMWNGEDSALLELDPKYAN
QTCGLCGDFNGLRAVNEFYAHNARLTPLQFGNLQKLDGPTEQCQDPPPAPADNCTDRDGI
CHRTLLGAAFAQCSRLVDAGAYVAACVQDLCRCPSCPCATFAEYSRQCAHAGGQPQNWRG
PDFCPRTCPLNLQHQECGSPCADTCSNPERSQLCEDHCVDGCFCPPGTMLDDITNTGCLP
LPQCPCAHGGRAYAPGASFSTPCSSCTCSGGLWQCQDLPCPGTCSVQGGSHISTYDEKLY
DLHGDCSYVLSKRCVDNGLTVLAELRKCGLTDSENCLKAVTLSMGGGATTVRIQANGGVL
MNSIYTQLPVSAANITMFRPSTFFILVQTGLGLQLEVQLVPLMQVVLRLDPAHRGQMCGL
CGNFNQNQADDLRALSGVVEGTAAAFANTWKTQAACPNVKNIFEDPCSLSVENENYAQHW
CSLLTSPAGAFSPCHSVVNPAPFHSNCLFDTCNCERSEECLCAALSSYVRACAAQGVLLR
GWRDGVCAKYMSSCPESQVYTYVVDRCQPTCRALSQADVTCAVPFVPVDGCTCPNGTFLN
DAGTCVSAEACPCYFRGSVVAPGEVLHDNGMVCSCARGKLNCLGATEQTSSGCVAPMVYL
DCSNASVGTPGAECLRSCHTLDVDCFSTHCMSGCVCPPGLVSDGSGGCVAEEDCPCLHNE
AAYRPGDTIRVDCNTCTCKSRRWECSHLPCLGTCVAYGDGHFITFDGEWYSFDGSCEYTL
AQDHCGGNGSTNGTFRIVTENVPCGTTGVTCSKAIKLFLENYELTLHEGTYKAVQRGPGG
GLPYRVRYMGTHLAIEARSGLVVSWDRKTSVLIRLQQDYKGRVCGLCGNFDDNAANDFTT
RSQSVVGDVLEFGNSWKFSPSCPDAPAPRDPCTANPYRKSWAQKQCSIINGPTFAACRSQ
VDPAKYYEACVSDACACDSGGDCECFCTAVAAYAQACRDVGVCVSWRTPDVCPLFCDYYN
PQGECEWHYQPCGAPCLRTCRNPSGRCLMDMPGLEGCYPRCPPSKPFFSEDQMKCVAQCG
CHDQDGKYYEVGASVPTTENCRSCDCTPSGIQCTHSPAACKCTYEGKTYSYGDVVYNTTD
GLGACLVAVCGDNGTIARWTMDCPGALSTTPFTFTSTAALPSTTSPAPTLSTVCVREVCH
WSAWYDSGHPEPGMGGGDFETFANLRQKGHQVCLAPAGIECRAQRLPDVPLEQLGQKVEC
SRQQGLTCLNSEQSPPLCHNYELRVLCCDLVPCSTAPGLGTSQEPTPTPTLQATTALTSQ
TQPTSPATAETRGTSSSVAPGTTCQPQCWWTEWFDEDYPKSEEAGGDIESYDKIRSAGGT
VCEWPQDIECRAEHFPDRSPEELGQRVHCDPRFGLVCRNDEQVGLFKMCYNYRIRVLCCS
QDHCEDHTTTTATTTATSTTTVTTTKPPVTEPWTWPGSSRGVTWPPSGSTTAMPFHSKGS
ESPTTSPNPRHTDTLETLATRRSMSPPSSTKTTTLGRATTPQGTTGGITTTRPTTGTPVG
TAGTASVSTRPASHSSVTTQSTETSPRMTSSTEATTSQSTTACQPKCEWTEWFDVDFPTS
GVTGGDMETYENIRAAGGHMCREPQKIECRAESYPEVSIDQIGQVVSCSLQAGLVCRNRD
QKGHFNMCFNYNVRVLCCDDASHCATITQTPTTTAQEGSYRTARTTGRASPTETTRGPRT
TGRTAGTSLLSATLKPSSTSHTATTRKAAACTAHCAWTDWYDTSFPMHGADGGEFETYAN
IRAAGRPLCERPVALQCRAELLPDVPLQQLGQVVVCGLQDGLVCRNRDQHGRFKMCLNYQ
IRVLCCDYSHCASTAPTSAPATSTRSGAPTSGGTTLWSTTTTRPLPSSPGTTQRVTTPTS
ETGISSTGTTQSVSTLTAETKPSAPGTSQRVTTTTALPGTTQRVTSLTSETGTSIPGTTE
TVTTSRTEPGPSSPGTTQRVTSLTSETGTSVPRTPQTITTTSTTTTASKPGPSSPGTSQR
VTTATSETGPSSSHHLCSRPPPQRQDPPPLGPQGHHHHLRDRPPRGPPDHLCDRTLLPWD
HPEGHHHHLRDRTLLPWDHPEGHQHHLCDRTSSPHHLSTRQVPPPLGLLYLPEGHQHHLC
DRTLLPWDHPEGHHHHLRDRTLLLCDRPEGHQHHLCLPWDHPEGPPPTSQRVTTTTSETG
SSSPGTSQRVTTTTSETGSSSPGTSQRVTTTTSLPGTTQRVTTTTSETGPSSSATAPRAS
TGVSRSAPVPEATSSLPGTTPGPSTTAPVATGTSGKTQTSSPVASEAGSTACQAHCAWTD
WYDTSFPLPGADGGEFETYANIRAAGRPLCERPVALQCRAELLPDVPLQQLGQVVVCGLQ
DGLVCRNRDQHGRFKMCLNYQIRVLCCDYSHCASTAPTSAPATSTRSGAPTSGGTTLWST
TTTRPLPSSPGTTQRVTTPTSETGISSTGTTQSVSTLTAETKPSAPGTSQRVTTTTALPG
TTQRVTTTTSETGSSSPGTSQRVTTTTSESSPPPPQRQVPPLRPPRGPPAPPLRQDPPPL
GPPRGSPPPPQRQVPPPLGPPRGHTTTSETGPSSPGTSQRVTTTTSETGPSSPATAPRAT
TTTSATGPSSPGTSQRVTTTTSLPGTTQRVTTTTPETGPSSSATAPRASTGVSRSAPVPE
ATSSLPGTTPGPSTTAPVATGTSGKTQTSSPVASEAGSTACQAHCAWTDWYDTSFPLPGA
DGGEFETYANIRAAGRPLCERPVALQCRAELLPDVPLQQLGQVVVCGLQDGLVCRNRDQH
GRFKMCLNYQIRVLCCDYSHCASTAPTSAPATSTRSGAPTSGGTTLWSTTTTRPLPSSPG
TTQRVTTPTSETGISSTGTTQSVSTLTAETKPSAPGTSQRVTTTTALPGTTQRVTSLTSE
TGTSIPGTTETVTTSRTEPGPSSPGTTQRVTSLTSETGTSVPRTPQTITTTSTTTTASKP
GPSSPGTTQRVTTTTSETGPSSPGTSQRVTTTTSETGTSSPGTTQRATSTTSATGPSSPG
TTQRFTTTTSETGPSSSATAPRATSTTSATGPSSPGTTQRVTATPTRVPGTEPWTRTRSS
PRGTQAPPGSSPAEHLTSTGTTSSPTSPHRTHTPKTSAVGSATSPTGSSKPVTAAVSSHP
AGSSRTAATPSTSAPTRTSSQPPAGPFTTSTGTSPVKEPTTRTSETAPRWPSTGPSTGAS
TGVSRSAPVPEATSSLPGTTPGPSTTAPVATGTSGKTQTSSPVASEAGSTACQAHCAWTD
WYDTSFPLPGADGGEFETYANIRAAGRPLCERPVALQCRAELLPDVPLQQLGQVVVCGLQ
DGLVCRNRDQHGRFKMCLNYQIRVLCCDYSHCASTAPPAPPPPAPAPERRLPAGRHSGAR
PPPGLCRPPLGPPRGSPLPRLRQESPPRGPPRASALSPLRPNLPLRGPARGSPPPRPYPG
QPSGPPDRCRPQRQDPPPLGPPRGSPPPPQRQVPPPLRPPRGPPAPPLRQDPPPLGPPRG
SPPPPQRQDPPPLGPPRGSPPPPQRQDPPPLGPPRGSPPPPQRQVPPLRPPGGPPPPQDH
PEGHHHHLRDRFTSLLPLSPATSETGSANSQRVTTTTSATGPSSSATAPRASTGVSRSAP
VPEATSSLPGTTPGPSTTAPVATGTSGKTQTSSPVASEAGSTACQAHCAWTDWYDTSFPL
PGADGGEFETYANIRAAGRPLCERPVALQCRAELLPDVPLQQLGQVVECGLQDGLVCRNR
DQHSRFKMCLNYQIRVLCCDYSHCASTAPTSAPATSTRSGAPTSGGTTLWSTTTTRPLPS
SPGTTQRVTTPTSGTGPSSSVTAPRATTTTSETGPSLPGTAPWVTATHIPLISVRTTETL
SVPSVSGSPGTPATKPAWPSGSASPTPSSLLSSRGPTLSLMPPSPATPCRCRAFGQLFLP
GDVVYNKTDSAGCHFYAICSPHCELDRFQGACPTSTPPGPPSAVPPTSAARGCDLADPPR
QVNETWTLENCTVAKCEGDNHIALLPPTPVSKVTCVNGREPIKVQSPQDPCESHYECECS
CSGWGGSKYRTFDGTNYSFRGNCTHVLVREIQPRFGNLSVLLNSYYCAAAAAPASCPRAL
VIRYGPTEVTLSTSTDASGREQSLILFDHVRVRSGFSSNGVSVSVTANGTMLVDIPAIGA
SVAMRGQAFHILLSYSRFGYNTEGQCGTCTNNRTDDCRQPDGTMAPTCQDMAHSWLVPEG
CWAPTGPPPTASSLPPAPTTSSASTCPPAPLCKLMLSQVFAECHSLVPPDPFFQTCVSDS
CQAGPAVPCQTLEAYAALCRARGACRDWRSATGGLCDLTCPPGKVYEPCGPVHPVTCDSR
NHSSENEALAEGCFCPDGHVLFNSYTDVCVPTCPCVGPDGFPKFPGERWVSNCQACECDE
GSVAVQCTPVKCEAHRPPPECSQAGFVSVSRPQADNPCCSETLCVCNATTCPQGPPECGP
GAELTRTLEEGGCCPTFTCRPKLCTYNGTVYGVGATFPATVPCHTCTCLSVDTQDPTVQC
KEEACNTACPQGSEYVRAAGQCCGECVPTACLTPDGRLVQPNETWVDSRVDNCTEYRCQD
ESGVHMLVPRPVTCRDVSSCRGILRKTGCCYTCEEVDSCQVRVNRTVLRHGDCEALVNVT
FCEGSCPGVSKYSAEAQAMQRQCTCCRETSTHQQAVTMQCPGGTAVQRTYTHVDACGCAP
SCAPSPAAPEHSTPVLPSYGAIV
NT seq 14832 nt   +upstreamnt  +downstreamnt
atgggcaccccgagcgggtgccagctgctggtgtgggcgctcctggccctgctctcactg
cagaaggcagcgacgggaggccagggcctcttcatggggctgccaccttacttcacggag
acctgccactggggccccatacagctgtcagacgtgtctggttttttcccgactcccacc
cctgtccccgcagagacccagggcagcacggagccgagcctggccagcacggaggccgcg
gcgaacagtcggagggcggacacagcccagcgtgtgaccttcatcccacctgttgccacc
taccccaccatgagcacctcgaacgcggcccacaacgggcgcgtgtgcagcacctggggc
gactcccactacaagaccttcgacggcgacgtcttccgcttccccggccgctgcaactac
gtcttctccgcgcactgcggcgccgcctacgaggacttcaacatccagctgcgccgcggc
ctggccggctccaggcccaccatcacccacatcgtcctcaagagccaggggctggtcctg
gaggtctccaacggctccgtcctcattgacgggcggcgggaggagctgccctacagccgg
gccgggctcctggtggagcagagcagcgactacacaaaggtcaacgtccggctgatgctg
accttcatgtggaacggagaggacagcgccctgctggagctggaccccaagtacgccaac
cagacgtgcggtctctgcggagacttcaacgggctccgggctgtcaacgagttctacgcc
cacaacgccaggctgacccctttacagtttgggaacctgcagaagctggacgggcccacg
gaacagtgccaggaccccccgcctgccccagccgacaactgcacagacagggacggcatc
tgccaccgcaccctgctgggcgcggccttcgctcagtgcagccgcctggtggatgccggt
gcgtacgtggccgcctgtgtccaggacctgtgccgttgccccagctgcccgtgcgccacc
tttgctgaatactcccgccagtgtgcccacgcggggggccagccgcagaactggaggggc
cccgacttctgcccccggacgtgccccctcaacctgcagcaccaggagtgtggctccccg
tgcgccgacacctgctccaaccccgagcggtcccagctctgtgaggaccactgtgtggac
ggctgcttctgccccccaggcacgatgctggacgacatcacgaacaccggctgcctgccc
ctgccgcagtgcccctgcgcccacggcggccgcgcctacgccccgggggcctcctttagc
accccctgcagctcctgcacctgttctggggggctgtggcagtgccaggacctcccgtgc
ccaggcacctgctccgtccagggcgggtcccacatctccacctacgacgagaaactctat
gacctgcatggggactgcagctacgtcctatccaagagatgcgtggacaacggcctcacc
gtgctggccgagctgcgcaagtgcggcctgacggacagcgagaactgcctcaaggcggtg
acgctgagcatgggcggtggggccacgaccgtccggatccaggccaacggcggcgtgctc
atgaactccatctacacccagctgcccgtgtcagcagccaacatcaccatgttcaggccc
tcgaccttcttcatcctggtgcagacgggcctcgggctgcagctggaggtgcagctggtg
cccctcatgcaggtggtcctcaggctggaccccgcccaccgaggccagatgtgcggtctc
tgcgggaacttcaaccagaaccaggccgacgacctgcgggccctcagcggcgtggtggag
ggcacagcggccgccttcgccaacacctggaagacgcaggccgcctgccccaacgtcaag
aacatcttcgaggacccctgctccctcagcgtggagaacgagaactacgcccagcactgg
tgctcgctgctgaccagcccggccggcgccttctcgccctgccactctgttgtcaacccc
gcgcccttccactcgaactgcctgttcgacacgtgcaactgcgagcggagcgaggagtgc
ctgtgcgccgccctgtcctcctacgtgcgcgcctgcgcggcccagggcgtgctgctccgc
ggctggcgggacggcgtctgcgccaagtacatgagcagctgccccgagtcccaggtgtac
acctacgtggtggaccggtgccagcccacctgccgcgccctgagccaggccgatgtcacc
tgcgccgtccccttcgtgcccgtggacggctgcacctgccccaacggcaccttcctgaat
gacgccggcacctgcgtgtccgcggaggcctgtccctgctacttccgcggctcggtcgtg
gcccctggggaggtgttgcacgacaacggcatggtgtgctcctgtgcgcgtgggaagctg
aactgcttgggagccactgagcagacaagctcagggtgcgtggcccccatggtgtacctg
gactgcagcaatgcctcggtgggcacgcccggcgccgagtgcctccggagctgccacacg
ctggacgtggactgctttagcactcactgcatgtctggctgcgtctgccccccggggctg
gtgtcagacgggagcgggggctgtgtggccgaggaggactgcccctgtctgcacaacgag
gccgcctaccggcccggggacaccatccgcgtcgactgtaacacctgtacatgcaagagc
cgcaggtgggaatgcagccacctgccctgcctgggcacctgcgtggcctacggtgacggc
cacttcatcaccttcgatggtgagtggtacagcttcgatggcagctgcgagtacaccctg
gcccaggaccactgcgggggcaacggcagtaccaacgggaccttccgcatcgtcaccgag
aatgtcccctgcgggaccacgggcgtcacctgctccaaggccatcaagctcttcctggag
aactacgagctgactctccacgagggcacctacaaggcagtgcagagggggccgggcggg
ggcctgccatacagggtccggtacatgggcactcacctggccatcgaggcccgcagcggc
ctggtcgtgtcctgggaccggaagaccagcgtgctcatccggctgcagcaggattacaag
ggcagggtctgcgggctgtgcgggaacttcgacgacaacgccgccaacgacttcaccacg
cggagccagtccgtggtgggcgacgtgctggagttcggcaacagctggaagttctccccg
tcctgccccgacgccccggcccccagggacccctgcaccgccaacccctaccgcaagtcc
tgggcgcagaagcagtgcagcatcatcaacggccccaccttcgccgcctgccgttctcag
gtcgaccccgccaagtactacgaggcctgcgtgagcgacgcctgcgcctgtgactccggc
ggcgactgcgagtgcttctgcacggccgtggccgcctacgcgcaggcctgccgcgacgtg
ggcgtgtgcgtgtcctggcgcaccccggacgtctgccccctgttctgcgactactacaac
cctcaaggggagtgtgagtggcactaccagccctgcggggcgccctgcctgaggacctgc
cggaaccccagcggccgctgtctgatggacatgccaggcctggaagggtgctacccccgg
tgccctcccagcaagccgttcttcagtgaagaccagatgaagtgtgtggcccagtgcggc
tgccacgaccaggacgggaagtactacgaggtgggcgccagcgtccccaccacggagaac
tgccggagctgtgactgcaccccgagcggcatccagtgcacacacagccccgcagcctgc
aagtgcacctatgagggcaagacctacagctatggggacgtcgtctacaacacgaccgac
gggctcggtgcctgcctggtcgctgtctgcggcgacaacgggaccatcgcccggtggacc
atggactgtcctggagccttgtccacgacacccttcaccttcacctccactgcagccctg
ccctccacgacaagcccggcgcccacgctctccactgtgtgcgtgcgcgaggtctgccac
tggtccgcctggtacgacagtggccacccagagcccggcatgggtggtggggacttcgag
acgtttgctaacctgaggcagaagggccaccaggtgtgcctggccccggccggcatcgag
tgccgggctcagcggctccctgacgtgcccctggagcagctgggccagaaggtggagtgc
agccggcagcaggggctcacatgcctcaacagcgagcagagtcccccgctctgccacaac
tatgagctgcgggtcctctgctgcgacctcgtgccctgcagcacagccccgggcctgggc
accagccaggagcccacgcccaccccgaccctccaggcaacaacggccttgacctcacag
acccaacccaccagccctgccacagctgagacccggggaaccagcagctctgtggcccca
ggcaccacctgtcagccccagtgttggtggacggagtggttcgatgaagattaccccaag
tctgaagaggccgggggggacatcgagtcttacgacaagatcaggagcgcagggggaact
gtgtgtgagtggcctcaggacatagagtgcagggcagagcacttccctgacaggagccct
gaggagctgggccagcgcgtgcactgtgaccccaggttcggcctggtctgcaggaacgat
gagcaggtgggactgttcaagatgtgttacaactacaggatccgcgtgctgtgctgcagc
caggatcactgtgaggaccacacaaccaccaccgccaccactactgccacctccaccact
actgtcaccactaccaaaccaccagtgacagaaccatggacctggccaggaagcagtcgg
ggggtgacatggcccccctcgggcagcactacagcaatgcctttccactcaaaaggatcg
gaatccccaacaacatccccgaaccccagacacacagacacactcgagacattggccaca
aggcgctccatgtctcctccgagctccacaaagaccaccaccctgggcagggccacaacc
cctcaggggaccacagggggcatcacgacaactcgccccaccacagggacacccgtgggc
acagcaggcactgcctccgtgagcacgcgacccgcctcacacagcagcgtgaccacacag
agcacagagacgtcgccgagaatgacgtcatccaccgaggccaccaccagccagagcaca
accgcctgccaacccaagtgcgagtggaccgaatggttcgatgtggacttccccacctca
ggggtcacaggtggagacatggagacctacgaaaacatcagggccgccggcggccacatg
tgccgggagccgcagaagatcgagtgccgggcggagagctaccccgaggtgagcatcgac
cagatcgggcaggtggtcagctgcagcctgcaggccgggctggtgtgcaggaaccgggac
cagaaggggcacttcaacatgtgtttcaactacaacgtgcgcgtgctctgctgcgacgat
gcgagccactgcgccaccataacccaaaccccgaccacgaccgcgcaggagggctcctac
aggaccgcccgcacgacggggcgggcctccccgacagagaccactcgagggccgcggaca
acaggccgcaccgctgggaccagcctgctctctgccacactgaagcccagctccacctct
cacactgcgaccaccaggaaggccgcggcctgcacggcgcactgcgcctggacggactgg
tacgacacgtccttcccgatgcatggcgccgacggcggggaatttgagacctacgccaac
atccgggcggccggcaggcccctctgcgagaggccagtggccctgcagtgccgggccgag
ctgctgcccgacgtgcccctgcagcagctgggccaggtggtggtgtgcggcctgcaggac
ggcctggtgtgccggaaccgggaccagcacggccggttcaagatgtgcctcaactaccaa
atccgcgtgctctgctgcgactacagccactgcgccagcacggccccgaccagcgccccc
gccaccagcacccgctccggagcgccgacttccggcgggacgacactctggagcacgacc
accacccggcctctgccgtcctcccctgggaccacccagagggtcaccactcccacgtct
gagacaggaatctcctccacggggaccacccagagcgtcagcactctcaccgctgagacc
aaaccttccgctccggggaccagccagagggtcaccaccaccacggccctacccgggaca
acccagcgggtcaccagcctcacctctgagacaggaacctctattcctggcaccaccgag
acggtcaccacctcaagaacggagcctggaccctcgtctcctgggaccacgcagagggtc
accagcctcacctctgagacaggaacctctgttcctaggaccccccagacgatcaccacc
accagcaccaccaccaccgcctccaagccaggaccctcctcccctgggaccagccagagg
gtcaccaccgccacctcagagacaggtccctcctcctctcaccacctctgttcacgacca
ccacctcagagacaggaccctcctcccctgggacctcagggtcaccaccaccacctcaga
gacagaccgccccgagggccaccagaccacctctgcgacaggaccctcctcccctgggac
cacccagagggccaccaccaccacctcagagacaggaccctcctcccctgggaccaccca
gagggccaccagcaccacctctgcgacaggacctcctcccctcaccacctcagcaccaga
caggtccctcctcccctgggactcctctacctccccgagggccaccagcaccacctctgt
gacaggaccctcctcccctgggaccacccagagggtcaccaccaccacctcagagacagg
accctcctcctctgcgaccgccccgagggccaccagcaccacctctgcctcccctgggac
cacccagagggaccacctccaaccagccagagggtcaccaccaccacctcagagacaggt
tcctcctcccctgggaccagccagagggtcaccaccaccacctcagagacaggttcctcc
tcccctgggaccagccagagggtcaccaccaccacgtccctacccgggacaacccagcgg
gtcaccaccaccacctcagagacaggtccctcctcctctgcgaccgccccgagggccagc
accggggtctcacgatcagcgccagtgcctgaggccaccagctccttgccaggcaccacc
ccgggcccctccacgactgcccccgtagctacagggacctcgggcaaaactcagacctct
agccctgtggcttcagaggccgggtccactgcctgtcaagcacactgcgcctggacggac
tggtacgacacgtccttccccctgccgggcgccgacggcggggaatttgagacctacgcc
aacatccgggcggccggcaggcccctctgcgagaggccagtggccctgcagtgccgggcc
gagctgctgcccgacgtgcccctgcagcagctgggccaggtggtggtgtgcggcctgcag
gacggcctggtgtgccggaaccgggaccagcacggccggttcaagatgtgcctcaactac
caaatccgcgtgctctgctgcgactacagccactgcgccagcacggccccgaccagcgcc
cccgccaccagcacccgctccggagcgccgacttccggcgggacgacactctggagcacg
accaccacccggcctctgccgtcctcccctgggaccacccagagggtcaccactcccacg
tctgagacaggaatctcctccacggggaccacccagagcgtcagcactctcaccgctgag
accaaaccttccgctccggggaccagccagagggtcaccaccaccacggccctacccggg
acaacccagcgggtcaccaccaccacctcagagacaggttcctcctcccctgggaccagc
cagagggtcaccaccaccacctcagagagctcaccaccaccacctcagagacaggtccct
cctctgcgaccgccccgagggccaccagcaccacctctgcgacaggaccctcctcccctg
ggaccacccagagggtcaccaccaccacctcagagacaggttcctcctcccctgggacca
cccagaggtcacaccaccacctccgagacaggaccctcctcccctgggaccagccagagg
gtcaccaccaccacctcagagacaggaccctcctcccctgcgaccgccccgagggccacc
accaccacctctgcgacaggaccctcctcccctgggaccagccagagggtcaccaccacc
acgtccctacccgggacaacccagcgggtcaccaccaccaccccagagacaggtccctcc
tcctctgcgaccgccccgagggccagcaccggggtctcacgatcagcgccagtgcctgag
gccaccagctccttgccaggcaccaccccgggcccctccacgactgcccccgtagctaca
gggacctcgggcaaaactcagacctctagccctgtggcttcagaggccgggtccactgcc
tgtcaagcacactgcgcctggacggactggtacgacacgtccttccccctgccgggcgcc
gacggcggggaatttgagacctacgccaacatccgggcggccggcaggcccctctgcgag
aggccagtggccctgcagtgccgggccgagctgctgcccgacgtgcccctgcagcagctg
ggccaggtggtggtgtgcggcctgcaggacggcctggtgtgccggaaccgggaccagcac
ggccggttcaagatgtgcctcaactaccaaatccgcgtgctctgctgcgactacagccac
tgcgccagcacggccccgaccagcgcccccgccaccagcacccgctccggagcgccgact
tccggcgggacgacactctggagcacgaccaccacccggcctctgccgtcctcccctggg
accacccagagggtcaccactcccacgtctgagacaggaatctcctccacggggaccacc
cagagcgtcagcactctcaccgctgagaccaaaccttccgctccggggaccagccagagg
gtcaccaccaccacggccctacccgggacaacccagcgggtcaccagcctcacctctgag
acaggaacctctattcctggcaccaccgagacggtcaccacctcaagaacggagcctgga
ccctcgtctcctgggaccacccagagggtcaccagcctcacctctgagacaggaacctct
gttcctaggaccccccagacgatcaccaccaccagcaccaccaccaccgcctccaagcca
ggaccctcctcccctgggaccacccagagggtcaccaccaccacctcagagacaggtccc
tcctcccctgggaccagccagagggtcaccaccaccacctcagagacaggaacctcctcc
cctgggaccacccagagggccaccagcaccacctctgcgacaggaccctcctcccctggg
accacccagaggttcacgaccaccacctcagagacaggtccctcctcctctgcgaccgcc
ccgagggccaccagcaccacctctgcgacaggaccctcctcccctgggaccacccagagg
gtcaccgccacccccacccgcgtgcccggcacggagccgtggacccgcaccaggagtagc
ccacgggggacgcaggccccccctggcagctccccggccgagcatttgacatccacgggg
accacgtcttcacccacgtccccgcaccgcactcacacgcccaagacatctgccgtcgga
agtgccacgtctcccacgggctcctcaaagcccgtcaccgcggcggtctcctcccaccct
gcagggagtagccgcactgcagcgacccccagcactagcgcccccacccgcaccagctcc
cagccacccgctggacccttcacgacctccacaggcacctccccagtcaaagagcccacc
acccgaacctcggagaccgctccccgatggcccagcaccgggcccagcacaggggccagc
accggggtctcacgatcagcgccagtgcctgaggccaccagctccttgccaggcaccacc
ccgggcccctccacgactgcccccgtagctacagggacctcgggcaaaactcagacctct
agccctgtggcttcagaggccgggtccactgcctgtcaagcacactgcgcctggacggac
tggtacgacacgtccttccccctgccgggcgccgacggcggggaatttgagacctacgcc
aacatccgggcggccggcaggcccctctgcgagaggccagtggccctgcagtgccgggcc
gagctgctgcccgacgtgcccctgcagcagctgggccaggtggtggtgtgcggcctgcag
gacggcctggtgtgccggaaccgggaccagcacggccggttcaagatgtgcctcaactac
caaatccgcgtgctctgctgcgactacagccactgcgccagcacggccccaccagcgccc
ccgccaccagcacccgctccggagcgccgacttccggcgggacgacactctggagcacga
ccaccacccggcctctgccgtcctcccctgggaccacccagagggtcaccactcccacgt
ctgagacaggaatctcctccacggggaccacccagagcgtcagcactctcaccgctgaga
ccaaaccttccgctccggggaccagccagagggtcaccaccaccacggccctacccggga
caacccagcgggccacctgacaggtgcagacctcagagacaggaccctcctcccctggga
ccacccagagggtcaccaccgccacctcagagacaggtccctcctcctctgcgaccgccc
cgagggccaccagcaccacctctgcgacaggaccctcctcccctgggaccacccagaggg
tcaccaccaccacctcagagacaggaccctcctcccctgggaccacccagagggtcacca
ccaccacctcagagacaggatcctcctcccctgggaccacccagagggtcaccaccacca
cctcagagacaggtccctcctctgcgaccccccggagggccaccaccaccacaggaccac
ccagagggtcaccaccaccacctcagagacaggttcacctctctcctgccactctcacct
gccacctcagagacaggctctgctaacagccagagggtcaccaccaccacctcagcgaca
ggtccctcctcctctgcgaccgccccgagggccagcaccggggtctcacgatcagcgcca
gtgcctgaggccaccagctccttgccaggcaccaccccgggcccctccacgactgccccc
gtagctacagggacctcgggcaaaactcagacctctagccctgtggcttcagaggccggg
tccactgcctgtcaagcacactgcgcctggacggactggtacgacacgtccttccccctg
ccgggcgccgacggcggggaatttgagacctacgccaacatccgggcggccggcaggccc
ctctgcgagaggccagtggccctgcagtgccgggccgagctgctgcccgacgtgcccctg
cagcagctgggccaggtggtggagtgcggcctgcaggacggcctggtgtgccggaaccgg
gaccaacacagccggttcaagatgtgcctcaactaccaaatccgcgtgctctgctgcgac
tacagccactgcgccagcacggcccccaccagcgcccccgccaccagcacccgctccgga
gcgccgacttccggcgggacgacactctggagcacgaccaccacccggcctctgccgtcc
tcccctgggaccacccagagggtcaccactcccacctctgggacaggtccctcctcttct
gtgaccgccccaagggccaccaccaccacctcagagacaggaccctcgctacccgggaca
gccccgtgggtcaccgccacccacataccactcatttctgtcagaaccactgagaccctc
tctgtccccagtgtctctggctccccagggactccagccaccaagcccgcctggcccagt
ggcagcgcgtcccccacgccctcgtccctcctcagctctcggggacccaccctgtcgctg
atgccacccagccccgccacgccctgtcggtgccgggccttcgggcagctcttcctccct
ggggacgtcgtgtacaacaagaccgacagtgccggctgccacttctacgccatctgcagc
ccgcactgcgagctggaccgcttccagggcgcctgtcccacctccacacccccagggccc
ccgtccgccgtgcctccgacctctgcagctcggggctgcgacctcgctgaccctccccga
caggtcaacgagacctggacgctggaaaactgcacggtggccaagtgcgagggtgacaac
cacatcgccctgctgccgccgacgccggtgtccaaggtcacctgtgtgaacgggcgcgag
cccatcaaagtgcagagcccgcaggacccctgcgagtcccactacgagtgcgagtgctcc
tgcagtggatggggtggctccaagtacaggaccttcgacggcacgaactactccttccgg
ggcaactgcacccacgtgctcgtgcgcgagatccagccccgcttcggcaacctcagcgtg
ctgctcaacagctactactgcgcggccgccgccgcccccgccagctgcccccgcgccctc
gtcatccgctacggccccacggaggtcaccctcagcaccagcaccgacgccagcgggcgt
gagcagagcctgatcctgtttgaccacgtgcgggtgaggtcgggcttcagcagcaacggc
gtgagcgtgtctgtgacggccaacggcacgatgctcgtggacatcccggccatcggagcc
agcgtcgccatgcgcgggcaagccttccacatcctgctgtcctacagccgcttcggctac
aacaccgagggccagtgcggcacctgcaccaacaacaggacggatgactgtcgccagccg
gacggcaccatggcccccacctgccaggacatggcccacagctggctggtccctgagggc
tgctgggcaccgaccggcccaccccccacggccagctccctgccccccgcacccaccacg
tcctctgccagcacgtgccccccggcgcccctctgcaagctgatgctgagccaggttttc
gccgagtgccacagcctcgtcccgcccgacccattcttccagacctgtgtcagcgacagc
tgccaggctggccccgcggtgccctgccagacgctggaggcctacgccgcactctgccgc
gccaggggcgcgtgccgtgactggcgcagtgccaccggcgggctgtgtgacctcacctgc
ccgcctggaaaggtatacgagccatgcggcccagtgcaccccgtgacctgtgactccagg
aaccacagctcggagaacgaggcgctggcggagggctgcttctgtccagacggccacgtc
ctcttcaactcctacacggacgtctgtgtgcccacgtgcccctgcgtgggaccagatggg
ttccccaaattccccggagagcggtgggtcagcaactgccaggcctgtgagtgcgacgag
ggctcagtggccgtgcagtgcacccccgtgaagtgcgaggcccaccgcccgcccccggag
tgcagccaggccggcttcgtgagcgtgagcaggccccaggccgacaacccgtgctgctcc
gagacactgtgcgtctgcaacgcgaccacctgcccccagggcccgccggagtgcgggcca
ggcgcggagctgacgcgcaccttggaggagggcggctgctgccccaccttcacctgccgg
cctaagctgtgcacttacaacggcaccgtctacggggtcggggccaccttcccagccacc
gtcccctgccacacgtgcacctgcctgtctgtggacacccaggacccgacggtgcagtgc
aaggaggaagcctgcaacaccgcctgtccccagggctctgagtacgtgcgagcagccggg
cagtgctgcggggagtgtgtccccaccgcctgcctcacgccagacggcaggctggtccag
cccaacgagacctgggtcgacagccgcgtggacaactgcactgagtaccgctgccaggat
gagagcggggtccacatgctggtcccaaggcccgtgacctgccgcgacgtgtccagctgc
aggggcatcctcaggaagactggctgctgctacacctgtgaggaagtggactcctgccag
gtccgcgtcaacaggaccgtcctgcggcacggggactgcgaggccctcgtcaacgtcacc
ttctgcgagggctcctgccccggggtgtccaagtactccgcggaggcccaggccatgcag
cggcagtgcacgtgctgccgggagaccagcacccaccagcaggcggtgaccatgcagtgc
cccggcgggacggccgtccagcgcacctacacccacgtggacgcgtgcggctgcgccccg
tcctgcgcgccctcgcctgcggctcccgagcacagcacccctgtccttccgtcctacggg
gccattgtctga

DBGET integrated database retrieval system