KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511714
Entry
107511714         CDS       T06036                                 

Gene name
ADRB1
Definition
(RefSeq) beta-1 adrenergic receptor
  KO
K04141  adrenergic receptor beta-1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04261  Adrenergic signaling in cardiomyocytes
ray04540  Gap junction
ray04923  Regulation of lipolysis in adipocytes
ray04924  Renin secretion
ray04970  Salivary secretion
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107511714 (ADRB1)
   04024 cAMP signaling pathway
    107511714 (ADRB1)
   04022 cGMP-PKG signaling pathway
    107511714 (ADRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107511714 (ADRB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107511714 (ADRB1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107511714 (ADRB1)
   04924 Renin secretion
    107511714 (ADRB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107511714 (ADRB1)
  09154 Digestive system
   04970 Salivary secretion
    107511714 (ADRB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107511714 (ADRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107511714 (ADRB1)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    107511714 (ADRB1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 107511714
NCBI-ProteinID: XP_016001853
LinkDB
Position
Unknown
AA seq 466 aa
MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLTSPPASPLTPASEGPTQLSQQWTAG
MGLLMALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARALVC
TVWAISALVSFLPILMHWWRAEGEEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLSGPARPASPAPSPGSPRPAAAPLANGRTSKRRPS
RLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDHLFVFFNWLGYANSAF
NPIIYCRSPDFRKAFQRLLCCARRNARGSHGAPRDRPRAPGCLAVAEPPPSPGAASDDDD
DDDDVGAEQPARLLEPWAGCNGRTAADSDSSLDEPSRPGCASESKV
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgggcgcgggggcgctcgccctgggcgcctccgagccctgcaacctgtcatccgccgcg
ccgctccccgacggcgcggccaccgcagcgcgactgctggtgctcacgtcgccgcccgcc
tcgccgctcaccccggccagcgagggccctacgcagctgtcgcagcagtggacagccggc
atgggcctgctgatggcgctcatcgtgctgcttatcgtggtgggtaacgtgctggtgatc
gtggccatcgccaagacgccgcggctgcagacgctcaccaacctcttcataatgtccctg
gccagcgccgacctggtcatggggctgctggtggtgccgttcggggccaccatcgtggtg
tggggccgctgggagtacggctccttcttctgcgagctctggacctcggtggacgtcctc
tgcgtgacggccagcatcgagaccctgtgcgtcattgccctggaccgctacctcgccatc
acgtcgcccttccgctaccagagcttgctgacccgcgcgcgggcgcgggccctcgtgtgc
accgtgtgggccatctcggccctggtgtccttcctgcccatcctcatgcactggtggcgg
gccgagggcgaggaggcgcgccgctgctacaacgaccccaagtgctgcgatttcgtcact
aaccgggcctacgccatcgcctcgtccgtggtctccttctacgtgcctctgtgcatcatg
gcgttcgtgtacctgcgggtgtttcgcgaggcccagaagcaggtgaagaagatcgacagc
tgcgagcgccgcttcctcagcggccccgcgcggccggcatcccccgcgccctcgccgggg
tccccgcgccccgccgccgccccgctggccaacgggcgcaccagcaagcggcggccctcg
cgcctcgtggccctgcgcgagcagaaggcgctcaagacgctgggcatcatcatgggcgtg
ttcacgctctgctggctgcccttcttcctggccaacgtggtgaaggccttccaccgcgac
ctggtgcccgaccacctcttcgtcttcttcaactggctgggctacgccaactcggccttc
aaccccatcatctactgccgcagcccagacttccgcaaggccttccagcgcctgctctgc
tgtgcgcgccggaacgcccgcgggagccacggggcaccccgcgaccggccgcgcgccccg
ggctgcctggcggtggccgagccgccgccgtcgcccggggccgcgtccgacgacgacgac
gacgacgacgacgtcggagccgagcagcccgcgcgcctgctggagccctgggccggctgc
aacggcaggacagcggcggacagcgactccagcctggacgagccgagccgcccaggctgc
gcctcggaatccaaggtgtag

DBGET integrated database retrieval system