KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511730
Entry
107511730         CDS       T06036                                 

Gene name
GCG
Definition
(RefSeq) glucagon isoform X1
  KO
K05259  glucagon
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04714  Thermogenesis
ray04911  Insulin secretion
ray04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107511730 (GCG)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107511730 (GCG)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107511730 (GCG)
   04922 Glucagon signaling pathway
    107511730 (GCG)
  09159 Environmental adaptation
   04714 Thermogenesis
    107511730 (GCG)
SSDB
Motif
Pfam: Hormone_2 Lipoprotein_10 MPM1
Other DBs
NCBI-GeneID: 107511730
NCBI-ProteinID: XP_016001901
LinkDB
Position
Unknown
AA seq 180 aa
MKSIYFLAGLFVMLVQGSWQRSLQDTEMKSSSFPAPQTDPFNDPDQMNEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVTIIEELRRRHADGSFSDEMNTVLDNLATRDFINWLLQTKITDRK
NT seq 543 nt   +upstreamnt  +downstreamnt
atgaaaagcatttactttttggctggattgtttgtgatgctggtacaaggcagctggcaa
cgttcccttcaggacacagagatgaaatccagctcattcccagctcctcagacagaccca
ttcaacgatccagatcagatgaatgaagacaagcgccattcacaaggcacattcaccagt
gactacagcaagtatctggactccaggcgtgcccaggattttgtgcaatggttgatgaac
actaagaggaacaagaataacattgccaaacgtcatgatgaatttgagagacatgctgaa
gggacctttaccagtgatgtaagttcttatttggaaggccaggctgccaaggaatttatt
gcttggctggtgaaaggccgaggaaggcgagatttcccagaagaagtcaccatcattgaa
gagctccgccgcagacacgccgatggctctttctctgatgagatgaacacagttcttgat
aatctcgccacccgagactttataaactggttgcttcaaaccaaaattactgacaggaag
taa

DBGET integrated database retrieval system