KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511813
Entry
107511813         CDS       T06036                                 

Gene name
STX1A
Definition
(RefSeq) syntaxin-1A
  KO
K04560  syntaxin 1A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04130  SNARE interactions in vesicular transport
ray04721  Synaptic vesicle cycle
ray04911  Insulin secretion
ray05016  Huntington disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    107511813 (STX1A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107511813 (STX1A)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    107511813 (STX1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    107511813 (STX1A)
   05022 Pathways of neurodegeneration - multiple diseases
    107511813 (STX1A)
  09165 Substance dependence
   05031 Amphetamine addiction
    107511813 (STX1A)
Membrane trafficking [BR:ray04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    107511813 (STX1A)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Prominin Laminin_II GNVR CorA Ferritin DUF148 SIMPL Lzipper-MIP1 FlgN Syntaxin-6_N YtxH DUF1910 PspA_IM30 ETRAMP Sec34 Med9 CHDCT2 Lipoprotein_2
Other DBs
NCBI-GeneID: 107511813
NCBI-ProteinID: XP_016002063
LinkDB
Position
Unknown
AA seq 288 aa
MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKISENVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH
STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASG
IIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHS
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASIFGGIFG
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaggaccgaacccaggagctccgcacggccaaggacagcgatgatgatgatgatgtc
actgtcactgtggaccgagaccgcttcatggatgagttctttgaacaggtggaggaaatc
cgcggcttcattgacaagatctcggagaacgtggaggaggtgaagcggaagcacagtgcc
atcctggcctcccctaaccctgatgagaagacgaaggaggagctggaggagctcatgtct
gacataaagaagacagcaaacaaagtgcgctccaagttgaagagcatcgagcaaagcatt
gagcaggaagaaggcctgaatcgctcatctgccgacctaaggatccggaagacgcagcac
tctacgctgtctcggaaatttgtggaggtcatgtctgagtacaacgcgacacagtctgac
tatcgagagcgctgcaagggccgcatccagaggcagctggagatcaccggcaggactaca
accagtgaggagctggaggacatgctggaaagtgggaacccggccatctttgcctctgga
atcatcatggactccagtatctcgaagcaggccctgagcgagattgagacgcggcacagt
gagatcatcaagctggagaacagcatccgtgagctgcacgacatgttcatggacatggcc
atgcttgtggagagccagggggaaatgattgacaggatcgaatacaatgtggagcactca
gtggactatgtggagagggccgtgtctgacaccaagaaggcagtcaagtaccagagcaag
gcgcgccggaagaagatcatgatcatcatctgctgtgtgatcctgggcattgtcattgcc
tccatctttggaggcatctttggatag

DBGET integrated database retrieval system