KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511848
Entry
107511848         CDS       T06036                                 

Gene name
MYBPC3
Definition
(RefSeq) myosin-binding protein C, cardiac-type isoform X1
  KO
K12568  myosin-binding protein C, cardiac-type
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107511848 (MYBPC3)
   05414 Dilated cardiomyopathy
    107511848 (MYBPC3)
SSDB
Motif
Pfam: I-set Ig_3 fn3 ig Ig_2 V-set THB C2-set_2 C1-set Invasin_D3 PKD_3
Other DBs
NCBI-GeneID: 107511848
NCBI-ProteinID: XP_016002176
LinkDB
Position
Unknown
AA seq 1291 aa
MTLSSHWTPTHSRRVVCCQGSPGSCGVEGAPPSLGPGPRPEPGKGEERRTSKLVRADSRG
CGHRRSVRAGEGEMQAGSPAQHEPPLTGSWGVRQEEGFWNLHPSEMPRRQCVFLEKVEPV
PGPAPAPAAPEAPGVPGEAVASATEVEGGSSGPEGSSSAVPNGHGAADDPIGLFVTRPQD
GEVTVGGSITFSAQVAGASLLKPPMVKWFKGKWVDLSSKVGQHLQLHDSYDRASKIYLFE
LHISDAQATFAGGYRCEVSTKDKFDSCNFNLTVHEAIGPGDLDLRSAFRRTSLAGGGRRI
SDSHEDAGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPASEYERIAFQHGVT
DLRGMLKRLKGMKRDEKKSTAFQKKLEPAYQVSKGHKIRLSVELADPDAEVKWLKNGQEI
QMSGSKYIFESNGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQ
LVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQKHHLIINEATLEDAG
HYALRTSGGQALAELIVQEKKLEVYQSIADLTVGAKDQAVFKCEVSDENVRGVWLKNGKE
LVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQE
PPKIHLDCPGRTSDTIVVVAGNKLRLDVPISGDPAPTVIWQKTVTQGKKAPAGPAPDASG
DAGASEEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN
LTVKVIDVPDAPAAPKISNVGEDSCTVHWEPPAYDGGQPVLGYILERKKKKSYRWMRLNF
DLLRELRHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPVGPPSEPTHLAVEDVSD
TTVSLKWRPPEREGAGGLDGYSVEYCQEGCSEWVPALQGLTERTSMLVKDLPTGARLLFR
VRAHNVAGPGAPVTTKEPVTVQEILQRPRLQLPRHLRQTIQRRVGEPVNLLIPFQGKPRP
QVTWTKEGQPLAGEEVSIRNSSTDTILFIRAAHRTHSGTYQVALRIENMEDKATLVLQII
DKPSPPVDIRVTETWGFNVALEWKPPQDDGNTEILGYTVQKADKKTMEWFTVLEHYRRTH
CVVSELIIGNGYYFRVFSHNMVGPSDSAATTKEPVFIPRPGITYEPPNYKALDFSEAPSF
THPLVNRSVIAGYNATLCCAVRGSPKPKVSWFKNGLDLGEDARFRMFSKQGVLTLEIRKP
CPFDGGVYICRATNLQGEAQCECRLEVRVPQ
NT seq 3876 nt   +upstreamnt  +downstreamnt
atgaccctgtcctcccactggacacccacacacagccggcgtgttgtgtgctgccaggga
agtcctgggagctgcggggtggagggagccccgcccagcctggggcctggaccaaggcca
gagcctgggaaaggggaggaacgacgtacttcaaagctggtcagggcagactcacggggg
tgtgggcacagacggtctgtgagggcaggagaaggcgaaatgcaggctggctccccagct
cagcatgagccacctctgacaggctcctggggggtgagacaagaggagggcttttggaat
cttcatccaagcgagatgcctcgtagacagtgtgtattcttagagaaggtggagcctgtg
ccaggccccgctcctgcccccgctgcccccgaggctcctggagttcccggagaagccgtg
gcctcagccactgaggtagaaggaggctcctcaggtccggaaggatcaagttcagcagtc
cccaatggccatggtgccgccgatgacccaatcggcctctttgtgacacggccgcaggat
ggcgaggtgactgtgggaggcagcatcaccttctcagcccaagtggctggggccagcctt
ctgaaaccacccatggtcaaatggttcaagggcaagtgggtggacctgagcagcaaggtg
ggccaacacctgcagctgcatgacagctacgaccgggccagcaagatctacctgttcgag
ctgcacatctcagatgcccaggccacatttgctggtggctaccgctgtgaggtgtccacc
aaggacaaattcgacagctgcaacttcaatctcacagtccacgaggccattggccctgga
gacctggacctccgatcagctttccgccgcacgagcctggccggaggcggtcgtcggatc
agtgacagccacgaggatgccgggattctggacttcagttcactgctgaagaagagagac
agtttccggaccccgcgggactcgaagctggaggctccggccgaggaggacgtgtgggag
atcctgcggcaggcgcccgcgtcggagtacgagcgcatcgccttccagcacggcgtcacg
gacctgcgcggcatgctcaagcggctcaagggcatgaagcgcgacgagaagaagagcaca
gcctttcagaagaagctggagcccgcctaccaggtgagcaagggccacaagatccggctg
agtgtggagctggcagaccccgacgccgaggtcaaatggcttaagaatggacaggagatc
cagatgagtggcagcaagtacatcttcgagtccaatggcgccaagcgtaccctgaccatc
agccagtgctcgctggcggatgacgcggcctaccagtgcgtggttggcggcgagaagtgc
agcaccgagctcttcgtgaaagagcccccggtgctgatcacgcggcccctggaggaccag
ctggtgatggtgggacagcgagtggagttcgagtgcgaagtctctgaggagggggcccag
gtcaaatggctgaaggatggggtggagctgacccgggaggagaccttcaaataccgcttc
aagaaggatggccagaaacaccacttgatcatcaacgaggcgacgctggaggacgctggg
cattacgcactgcgcaccagtgggggccaggcgctggccgagctcatcgtgcaggagaaa
aagctggaggtgtaccagagcatcgcggacctgacggtgggtgcaaaggaccaggccgtg
ttcaagtgtgaggtgtcagatgagaacgtgcggggcgtgtggctgaaaaatgggaaggag
ctggtgcctgacagccgaataaaagtgtcccacattgggcgagtccacaaactgaccatt
gatgacgtcacacctgcagacgaggctgactacagctttgtgcctgagggctttgcctgc
aacctgtccgccaagctccacttcatggaggtcaagatcgacttcgtgcccaggcaagaa
cctccgaagatccacctggactgcccaggtcgcacatcggataccattgtggtcgtggct
gggaacaagctacgcctggatgtccctatttctggggaccctgctcccactgtgatttgg
cagaagacagtcacacaggggaaaaaggcccctgctgggccagccccagatgcctccggg
gatgcaggtgccagtgaggagtgggtgtttgacaagaagctgctgtgtgagaccgagggc
cgggtccgagtggagaccaccaaggaccgcagcatcttcacggtcgagggggcagagaag
gaagacgagggtgtctacaccgtcacggtgaagaaccctgtgggcgaggaccaggtcaac
ctgacagtcaaggtcatcgacgtgccggacgcccctgcagcccccaagatcagtaacgtg
ggcgaggactcctgcacggtgcattgggagccgcccgcctatgacggcgggcagccagtc
ctgggctacatcctggagcgcaagaagaagaagagctaccggtggatgcggctgaacttc
gacctgctgcgggagctgagacacgaggccaggcgcatgatcgagggcgtggtttacgag
atgcgcgtctacgcggtcaacgccatcggcatgtctaggcccagccccgcctcccagccc
ttcatgcccgtggggccccccagtgagcccacccacctggcagtggaggatgtctctgac
accacggtctccctcaagtggcggcccccggagcgtgagggagctggaggcctggacggc
tacagtgtggagtactgccaagagggctgctcagagtgggtgcctgccctgcaggggctg
acagagcgcacatccatgctggtgaaggacctgcccaccggggcccggctgctctttcgg
gtgcgggcgcacaatgtggcagggcctggagcccctgtcaccaccaaggagcctgtgacg
gtgcaggagatactgcagcggccacggctccagctgcccaggcacctacgccagaccatc
cagaggagggtcggggagcccgtgaacctcctcattcctttccagggcaagccccggcct
caggtgacctggaccaaagaggggcagccactggccggcgaggaggtgagcatccgaaac
agctctacggacaccatcctgttcatccgggccgctcaccgcacccactccggcacctac
caggtggctctgcgcattgagaacatggaggacaaggcgacactggtcctgcagatcatt
gacaagccaagtcctccagtggatattcgggtcacagaaacgtggggtttcaatgtggct
ttggagtggaagccaccccaagatgatggcaacacagagatcttgggttacacagtacag
aaagctgacaagaagaccatggagtggttcactgtcttggagcactaccgccgaacccac
tgcgtggtgtcagagcttatcattggcaatggctactacttccgggtcttcagtcataac
atggtggggcccagcgacagtgctgccaccaccaaggagcctgtcttcatccctagacca
ggcatcacatatgagccacccaactacaaggccctggacttttctgaggccccaagcttc
acccaccccctggtgaaccgctcagtcatcgccggctacaatgctaccctctgctgtgcc
gtccggggtagtcccaagcccaaggtttcctggttcaagaatggcctggacctgggagaa
gatgcccgcttccgcatgttcagcaagcagggagtgttgaccctggagatcagaaagccc
tgcccctttgacgggggtgtctacatctgcagggccaccaacttacaaggcgaggcacag
tgtgagtgccgcctggaggtgcgagtacctcagtga

DBGET integrated database retrieval system