KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511851
Entry
107511851         CDS       T06036                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03420  Nucleotide excision repair
ray04115  p53 signaling pathway
ray04120  Ubiquitin mediated proteolysis
ray05161  Hepatitis B
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107511851 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    107511851 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    107511851 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511851 (DDB2)
   05202 Transcriptional misregulation in cancer
    107511851 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107511851 (DDB2)
   05212 Pancreatic cancer
    107511851 (DDB2)
   05225 Hepatocellular carcinoma
    107511851 (DDB2)
   05226 Gastric cancer
    107511851 (DDB2)
   05214 Glioma
    107511851 (DDB2)
   05216 Thyroid cancer
    107511851 (DDB2)
   05220 Chronic myeloid leukemia
    107511851 (DDB2)
   05217 Basal cell carcinoma
    107511851 (DDB2)
   05218 Melanoma
    107511851 (DDB2)
   05213 Endometrial cancer
    107511851 (DDB2)
   05224 Breast cancer
    107511851 (DDB2)
   05222 Small cell lung cancer
    107511851 (DDB2)
   05223 Non-small cell lung cancer
    107511851 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107511851 (DDB2)
   05169 Epstein-Barr virus infection
    107511851 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107511851 (DDB2)
   03400 DNA repair and recombination proteins [BR:ray03400]
    107511851 (DDB2)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     107511851 (DDB2)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      107511851 (DDB2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 107511851
NCBI-ProteinID: XP_016002185
LinkDB
Position
Unknown
AA seq 461 aa
MLQKVHVMKPPSLLPGYRLHQEPQGIVPLRTEDTMASRKRPETRKTPEVVVRRKSKRSRS
PRELEPEAKKLCVKGPGSSRRFDSGCLWAGLASLQVSSPCRNIVRALHHHKLGKAAWPSV
QQSLQQSFLQSLASYRIFQKAAPFDRRATSLAWHPTHPSTLAVGSKGGDIMLWNFGIKDK
PTFIKGIGAGGSITGLKFNPLNTHQFFTSSMEGMTRLQDFKGNTLQVFTSYSICNFWFCS
LDVSATSRVVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCDQFLATASVDQT
VKIWDLRQVKGKSSFLYSLPHRHPVNAAHFSPDGAQLLTTDQNSEIRVYSASQWDRPPSL
IPHPHRHFQHLTPIKAAWHPRYNFIVVGRYPDPNFKSCTPYELRTIDVFDGSSGKLMHQL
YDPESSGIISLNEFNPMGDTLASVMGYHILIWSQEEAGMQK
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgttgcagaaagtgcatgtgatgaaacctccctcactccttccaggctatcggcttcac
caagaaccacagggtatagtaccccttcgcacggaggacacgatggcttccaggaaacgc
ccagaaacccggaagacccctgaggtggttgtgcgccgcaaaagcaagaggagcagaagc
ccccgagagttggagcccgaggccaagaagctctgtgtgaagggccccggttctagcaga
agatttgactcaggctgcctttgggcggggttggctagcctgcaggtctcatcaccatgc
aggaatatcgtcagggccctccatcaccataagttgggcaaagctgcttggccatcagta
cagcagagtctccagcagtcctttttgcagtctctggcttcttaccggatattccaaaag
gctgccccctttgacaggagggccacatccttggcatggcacccaactcaccccagcacc
ctggctgtaggttccaaagggggagatatcatgctctggaactttggcataaaggacaaa
cctaccttcattaaagggattggagctggagggagcatcactgggctgaagtttaaccct
ctcaatacccaccagtttttcacctcctcaatggagggaatgactaggctacaagacttt
aaaggcaacactctccaagtttttaccagctacagcatctgcaacttctggttttgcagc
ctggatgtgtctgccacaagccgagtggtggtcacaggagacaatgtagggaacgtgatc
ctgctgaacatggacggcaaggagctttggaatctgagaatgcacaaaaagaaagtgacc
catgtggccctgaacccatgctgtgatcagttcctggccacagcctctgtagatcaaaca
gtgaaaatctgggacctgcgccaggttaaagggaaatccagcttcctctactcgctgcca
cacaggcatcctgtcaacgcagctcatttcagtcccgatggagcccagctgctgaccact
gaccagaacagtgagatccgggtttactctgcctcccagtgggaccgccccccgagcctg
atcccgcaccctcaccgccacttccagcacttgacgcccatcaaggcagcctggcatcct
cggtacaatttcattgttgtgggccgatacccagatcctaatttcaaaagctgtaccccc
tatgaattaaggacaatcgatgtatttgatggaagctcagggaagttgatgcatcagctc
tatgacccagaatcttctggtatcatttcgctcaatgagttcaatcctatgggagacacg
ctggcctctgtgatgggttatcacattctcatttggagccaagaggaagctgggatgcaa
aaatga

DBGET integrated database retrieval system