KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511865
Entry
107511865         CDS       T06036                                 

Gene name
CHRM4
Definition
(RefSeq) muscarinic acetylcholine receptor M4
  KO
K04132  muscarinic acetylcholine receptor M4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04725  Cholinergic synapse
ray04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107511865 (CHRM4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107511865 (CHRM4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107511865 (CHRM4)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    107511865 (CHRM4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 107511865
NCBI-ProteinID: XP_016002240
LinkDB
Position
Unknown
AA seq 478 aa
MANFTPVNGSSGNQSVRLVTSAHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR
QLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASVM
NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP
DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT
LAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPVLPPPPRPMADKDTSNESSSGSA
TQNTKERPLTELSTTEATTPATPAPSLQPRALNPASKWSKIQIVTKQTGNECVTAIEIVP
ATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVL
VNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcgaacttcacaccagtcaatggcagctctggcaaccagtcggtgcggctggtcaca
tcagcccataaccgctacgagacggtggaaatggtgttcatcgccacggtgacaggttcg
ctgagcctggtgaccgtcgtgggtaacatcttggtgatgctgtccatcaaggtcaacagg
cagctgcagacagtcaacaactacttcctcttcagcctggcatgtgctgatctcatcata
ggcgctttctccatgaacctctacaccgtgtacatcatcaaaggctactggcctctgggc
gccgtggtctgtgacctgtggctggccctggactatgtggtgagcaatgcctctgtcatg
aaccttctcattatcagctttgaccggtacttctgcgtcaccaagcccctcacctaccct
gcccggcgcaccaccaagatggcaggcctcatgatcgccgctgcctgggtcctgtccttt
gtgctctgggcgcctgccatcctgttctggcagtttgtggtgggcaagaggacagtgcca
gacaatcagtgcttcatccagttcctgtccaacccggcggtgacctttggcacggccatc
gctgccttctacctgcccgtggtcatcatgacggtgctctacattcacatctccctggcc
agtcgcagccgagttcacaagcaccggcccgaaggccctaaggagaagaaggccaagact
ctggccttcctcaagagccccctcatgaagcaaagcgtcaagaaacccccgccgggagaa
gctgctcgagaggagctgcgcaacgggaaactagaggaggcccctccaccagtcttgcca
cccccgccgcgcccgatggccgacaaggacacttccaatgagtccagctcaggcagtgcc
acccagaacaccaaggaacgaccactcacagagctgtcaaccacagaggccaccacgcct
gccacacccgccccttccctacagccacgggccctcaacccggcctccaaatggtccaag
attcagatagtgacgaagcagacaggcaatgagtgtgtgacagccatcgagattgtgcct
gccacaccagctggtatgcgtccggcagccaacgtggcccgcaaatttgccagcatcgcc
cgaaaccaggtgcgcaagaagcggcagatggcggcccgggaacgcaaggtgacacggacc
atctttgccattctgttggccttcatcctcacctggacgccctacaacgtcatggtcctg
gtgaacaccttctgccagagctgcatccctgacactgtgtggtccattggctactggctc
tgctatgtcaacagtaccatcaaccctgcctgctatgccctctgcaatgccaccttcaaa
aaaaccttcaggcacctgctgctttgccagtatcggaacatcggcactgccaggtag

DBGET integrated database retrieval system