KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511968
Entry
107511968         CDS       T06036                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01524  Platinum drug resistance
ray04141  Protein processing in endoplasmic reticulum
ray04210  Apoptosis
ray04215  Apoptosis - multiple species
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05160  Hepatitis C
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05203  Viral carcinogenesis
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107511968 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107511968 (BAK1)
   04215 Apoptosis - multiple species
    107511968 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511968 (BAK1)
   05202 Transcriptional misregulation in cancer
    107511968 (BAK1)
   05206 MicroRNAs in cancer
    107511968 (BAK1)
   05203 Viral carcinogenesis
    107511968 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107511968 (BAK1)
   05212 Pancreatic cancer
    107511968 (BAK1)
   05225 Hepatocellular carcinoma
    107511968 (BAK1)
   05226 Gastric cancer
    107511968 (BAK1)
   05214 Glioma
    107511968 (BAK1)
   05216 Thyroid cancer
    107511968 (BAK1)
   05220 Chronic myeloid leukemia
    107511968 (BAK1)
   05217 Basal cell carcinoma
    107511968 (BAK1)
   05218 Melanoma
    107511968 (BAK1)
   05213 Endometrial cancer
    107511968 (BAK1)
   05224 Breast cancer
    107511968 (BAK1)
   05222 Small cell lung cancer
    107511968 (BAK1)
   05223 Non-small cell lung cancer
    107511968 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    107511968 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107511968 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107511968 (BAK1)
   05160 Hepatitis C
    107511968 (BAK1)
   05164 Influenza A
    107511968 (BAK1)
   05162 Measles
    107511968 (BAK1)
   05168 Herpes simplex virus 1 infection
    107511968 (BAK1)
   05163 Human cytomegalovirus infection
    107511968 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107511968 (BAK1)
   05169 Epstein-Barr virus infection
    107511968 (BAK1)
   05165 Human papillomavirus infection
    107511968 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107511968 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ray03029]
    107511968 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107511968 (BAK1)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    107511968 (BAK1)
Transporters [BR:ray02000]
 Other transporters
  Pores ion channels [TC:1]
   107511968 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 107511968
NCBI-ProteinID: XP_016002456
LinkDB
Position
Unknown
AA seq 211 aa
MASGQCPGPPRQECEEPAPSSTSEEQVARDTEEVFRSYVFYRHQQEQEADGAAVPADPEM
VTLSLEPASTMGQVGRRLAIIGDDINQRYDEEFQTMLQRLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLTVLAVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcgtctgggcaatgcccgggccctcccagacaggagtgtgaagagcctgccccatcc
tccacttcggaggagcaggtagcccgagacacagaagaggttttccgcagctacgttttt
taccgccatcagcaggagcaggaggctgatggggcggctgtgcctgctgacccagagatg
gtcaccttgtccctagaacctgccagcaccatggggcaggtgggacggcggctcgccatc
atcggggacgacatcaaccagcgctacgacgaagagttccagaccatgttgcagcgcctg
cagccgacagcagagaacgcctatgagtatttcaccaagatcgcctccagcctatttgag
agcggcatcaactggggccgagtggtggctctcctaggctttggctaccgcctggctcta
catgtttaccagcgtggcctgactggcttcctgggccaggtgactcgctttgtggctgac
ttcatgctgcatcattgcatcgcccggtggattgcacagagaggcggttgggtggcagcc
ctgaacttgggcaacggccccatccttaatgtgctgacagttctggctgtggttctgttg
ggtcagtttgtggtacgaagattcttcaagtcatga

DBGET integrated database retrieval system