KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512136
Entry
107512136         CDS       T06036                                 

Gene name
MRVI1
Definition
(RefSeq) protein MRVI1 isoform X1
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107512136 (MRVI1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107512136 (MRVI1)
SSDB
Motif
Pfam: MRVI1 Nucleo_P87
Other DBs
NCBI-GeneID: 107512136
NCBI-ProteinID: XP_016002818
LinkDB
Position
Unknown
AA seq 978 aa
MALSLKHSSPFWNSYVYSKDQIRCKISMATSDFVNRTSEQEEMQFQLPSIFTSGVDANSS
RLSLWLMTPGNGTQLGSGMGVDLTCPFGISSACEAQASWSIFGADAAEVPGICGHSHQEA
AMPHIPEDEEPPGEPQAAQSPTSQAPLTTGITCSPPTIVLTGDASSLEGETDKNLANRAH
SPHRRLSHRHLKVSTASLTSVDSAGHVIDLVNDQLPDISISEEDKKKNLALLEEAKLVSE
RFLSRRGRKSRSSPGDSPSAISPNLSPGVSPASSRSNSLTIPTPPGLDACSGPQSPLPGA
PPQQKEDEAKVSSPYLGEPNIPKGLADRKQNDQRKVSQGRLTPRSPTVEKSKEIAIEQKE
NFDPLQCPEATPKGPASGTGSGGKMALNSPQPGPAESGLAQPLLKTAREGNPLPRSPAQG
SGGVVPLAPQGKSTAVEPTGSKAGSKAELRPPLLRGVSWDSGPEEPGPLLQKVLAKLPLA
EEEKRFAGKASSKLAKAPGLKDFQIQVQPVRMQKLSKLREEHILMRNQNLVGLKLPELSE
AAEQEKGLPSELIPAVEEEESKSGLDVMPNISDVLLRKLRVHKSLPGSAPPLTEKEVENV
FVQLSLAFRNDSYTLESRINQAERERNLTEENTEKELENFKASITSSASLWQHCEHRETY
QKLLEDIAVLHRLAARLSSRAEMVGAVRQEKRMSKATEVMMQYVENLKRTYEKDHAELME
FKKLANQNSSRSCGPSEDGVPRTARSMSLTLGKNMPRRRVSVAVVPKFNALNLPSQPPSS
SPLPSLPALSESPSGKGNLPVVTSALPALLENGKTNGDPECEASAPMPTPICLEEISQVT
KARMEEEAYNKGYQEGLKKTKELQDLKEEEEEQKSESPEEPEEIEETEEEEEKNQRSSKL
EELIHFLQVMYPKLCQHWQVIWMMAAAMLVLTVVLGLYNSYNSCVEQADEPLGRSTCSAA
QRDSWWSSGLQHEQPTEQ
NT seq 2937 nt   +upstreamnt  +downstreamnt
atggctttgagtttgaagcactcttctcccttttggaacagctatgtttacagtaaagac
caaattagatgcaaaatctctatggccacctctgactttgtaaacagaactagtgaacag
gaggaaatgcaattccaattgccctcgattttcacctctggtgttgacgcaaactcaagc
aggctctctctgtggctcatgacccctggaaatggaacccagctcgggtcagggatggga
gtggatttgacttgtccttttggcatctcctcagcctgcgaagcccaggcctcttggagc
atctttggggctgacgcagcagaggttccgggcatctgtggccactcccaccaggaggct
gccatgccccacattcccgaggatgaggagccccccggagagccacaggcagcccagagc
cctaccagccaagcccctctcaccacaggaataacttgcagtccacctaccattgttctc
actggggatgccagttcactggaaggagaaactgacaaaaacctggccaacagagctcac
agtccccacaggaggctttctcaccgacacttgaaggtttctactgcttcgctgacttct
gtggactctgcggggcacgtcattgacctggtaaatgaccagctgccagatatcagcatc
tcagaggaggacaagaagaaaaacctggcactgctggaagaagccaagttggtgagtgag
cgattcctaagccgccgcgggaggaagtccaggagcagccccggagactccccgtcagct
atttccccaaacctcagccccggagtttctccggcatcctctcggagcaactcactcacc
atccccacgccacctggtttggatgcatgcagtggcccacagtcccctctacctggagca
ccaccacagcagaaggaggatgaggccaaagtctcttcaccttatcttggcgagcctaat
atccccaaagggctagctgaccggaagcagaatgaccagaggaaagtgtctcaaggcagg
ctaactcctcgttctcctacagtcgaaaaatccaaagagattgcaatagaacaaaaggaa
aactttgatcccctccagtgccctgaggccacacccaaaggcccagcttctggcacaggc
agtggtgggaaaatggccctaaacagcccccagcctggccctgccgagagcgggcttgcc
cagccattactgaagacagccagggagggcaaccctctgcccagaagtccagcccagggc
tctggaggggtggttcccctggccccccagggaaaaagcacagctgtagagccaacgggg
tccaaggctggctccaaagctgagcttcggccaccgctgctgcggggggtctcctgggac
agcggccctgaagaacctggccccctgctacagaaagtgcttgccaagctgccactggca
gaagaagagaagcgttttgcaggcaaagccagcagcaagctggccaaggctcctggactc
aaagactttcagatacaagtgcagcctgtgcggatgcagaaactgtcgaaactccgtgag
gagcacatcctgatgagaaatcagaacttagtggggctcaaacttccagaacttagtgaa
gcagctgagcaagaaaaagggctcccttctgaactcatcccagctgttgaggaagaagaa
tcaaagagtggcttggatgtcatgcccaatatttctgatgtgctgctgcgtaaactgcga
gtccacaagtctctccctggaagtgcccctccgctcactgaaaaggaagtcgagaacgtc
tttgtacaactgtccttggcctttagaaatgacagctacaccctggaatctagaattaac
caggccgaaagggaacgtaacctgacagaggagaacactgagaaggaactggaaaacttc
aaagcttccattacgtcctcagcttcactctggcagcactgtgagcaccgggagacctat
cagaagctgctggaggacattgctgtcctgcaccgcttggctgcccgcctctccagcaga
gctgagatggtgggggctgtccgccaggaaaagcgcatgtcaaaggcaacagaggtgatg
atgcagtatgtggagaacctgaagaggacgtatgagaaggaccatgcagagctcatggaa
tttaaaaagcttgcaaatcagaattcaagccgtagctgcggcccctcggaagatggggtc
cctcgcacagcgcggtccatgtccctcacgctgggaaagaacatgccccgccgcagggtc
agcgttgctgtggttcccaagtttaatgccctgaacctgcccagtcaacctccaagctca
tctcccctcccctccttaccagccctgtcagaatcacccagtgggaaaggcaacctacct
gtcgtcacctcagcattgcctgcacttttggaaaatggaaaaacaaatggagacccagag
tgtgaagcctctgctcccatgccgactccgatctgcctggaggagattagccaggtgacc
aaggccaggatggaggaagaagcgtacaacaaaggataccaggaaggtctaaagaagacc
aaagagcttcaagacctaaaggaggaggaggaagaacaaaagagtgagagtcctgaggaa
cctgaagagatagaagagactgaagaagaagaagaaaagaaccagagaagcagcaaactt
gaagaattgattcatttcttacaagtcatgtatcctaaactgtgtcagcactggcaagtt
atctggatgatggctgcagcgatgctggtcttgactgttgttctgggactgtacaattcc
tataactcttgtgtggaacaggctgatgagccccttgggagatccacttgctccgcagcc
cagagagactcctggtggagctcaggactccagcatgagcagcctacagagcagtag

DBGET integrated database retrieval system