KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512141
Entry
107512141         CDS       T06036                                 

Gene name
ADM
Definition
(RefSeq) ADM
  KO
K12333  adrenomedullin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107512141 (ADM)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107512141 (ADM)
SSDB
Motif
Pfam: Calc_CGRP_IAPP Fibrinogen_C
Other DBs
NCBI-GeneID: 107512141
NCBI-ProteinID: XP_016002835
LinkDB
Position
Unknown
AA seq 188 aa
MKLVPVALLCLGSLAFLGADSARLDVASEFRKKWNKWALSRGKRELRVPSSYPTGLADLK
SEPVQTLVQPQDVKGTSRSTQASSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKL
AHQIYQFTDKDKDGVAPRNKISPQGYGRRRRRSLPEAGQGRTLLSPEPRERGAPASGALR
VIATLHRI
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaaactggttccagtcgccctcctgtgtttgggttcgctcgccttcctaggagcggac
agcgcacggctcgatgtggcgtcagagttcagaaagaaatggaataaatgggcgctaagt
cgtgggaagagggaacttcgggtgcccagcagctaccctaccgggctcgccgacctgaag
tccgagcctgtccagactctcgttcagccgcaggatgtaaagggaacctctcgcagcacc
caggccagcagtccggacgccgcccgcatccgagttaagcgctatcgccagagtatgaac
aacttccagggcttgcggagctttggctgtcgcttcgggacgtgcacggtgcagaagctg
gcacaccagatctaccagttcacagacaaggacaaggacggcgttgcccccaggaataag
atcagccctcagggctacggccgccggcgccggcgatccctgcccgaggcgggccagggc
cggactctgttgtccccggagccacgagaacgcggggctccagcttctggagcgcttcga
gtgattgctaccctccataggatttag

DBGET integrated database retrieval system