KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512205
Entry
107512205         CDS       T06036                                 

Gene name
RIMS2
Definition
(RefSeq) regulating synaptic membrane exocytosis protein 2 isoform X1
  KO
K15297  regulating synaptic membrane exocytosis protein 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107512205 (RIMS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107512205 (RIMS2)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    107512205 (RIMS2)
  Small GTPases and associated proteins
   Rab associated proteins
    107512205 (RIMS2)
SSDB
Motif
Pfam: C2 FYVE_2 PDZ_6 PDZ Nudix_N_2
Other DBs
NCBI-GeneID: 107512205
NCBI-ProteinID: XP_016002949
LinkDB
Position
Unknown
AA seq 1482 aa
MSAPVGPRGRPAPAPAASQPPLQPEMPDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKI
KEEHKPQLTQWFPFSGITELVNNVLQPQQKQQNEKEPQTKLHQQFEMYKEQVKKMGEESQ
QQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKEDKVVMWVCNL
CRKQQEILTKSGAWFYNSGSNTPQQPDQKVLRGMRNEEAPQEKKAKLHEQAQFQGPSGDL
SVPAVEKSRSHGLTRQDSIKNGSGVKHQIASDIASDRKRSPSVPRDQNRRYDQREEREEY
SQYATSDSAMPRSPSDYADRRSQREPQFYEESDHMNYRDSNRRSHRHSKEYIVDDEDVES
RDEYERQRREEEYQSRYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERRHSDVSLANA
ELDDSRISMLRMERPSRQRSISERRAAMENQRSYSMERTREAQGPTSYPQRTTNHSPPTP
RRSPIPIDRQDMRRTDSLRKQHHLDPSSAVRKTKREKMETMLRNDSLSSDQSESVRPPPP
KPHKSKKGGKMRQVSLSSSEEELASTPEYTSCEDVEIESESVSEKGDSQKGKRKTSEQAV
LSDSNTRSERQKKMMYFGGHSLEEDLEWSEPQIKDSGVDTCSSTTLNEEHSHSDKHPVTW
QPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLA
DTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRPIGDIPRIPDSTH
PQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQFLSGQLSSQSLSRRTTPFVPRVQI
KLWFDKVGHQLIVTILGAKDLPSRDDGRPRNPYVKIYFLPDRSDKNKRRTKTVKKTLEPK
WNQTFIYSPVHRREFRERMLEITLWDQARVREEESEFLGEILIELETALLDDEPHWYKLQ
THDVSSLPLPHPSPYMPRRQLHGESPTRRLQNKALCSYNSGSKRISDSEVSDYDCDDGIG
VVSDYRHNGRDLQSSTLSVPEQVMSSNHCSPSGSPHRVDVIGRTRSWSPSVPPPQSRNVE
QGLRGTRSTTGHYNTISRMDRHRVMDDHYSPDRDSHFLTLPRSRYSQTTEHHHRDGRDCE
AADRQPYHRSRSAEQRPLLERTTTRSRSTERPDTNLMRSMPSLMTGRSAPPSPALSRSHP
RTGSVQTSPSSTPVAGRRGRQLPQLPPKGTLERNNGVKEIEPYEEAGGKKLRSTVQRSTE
TGLAVEMRNWMTRQASRESTDGSMNSYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQLVG
RQTLATPAMGDIQVGMMDKKGQLEVEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAK
KKTKVARKTLEPLYQQLLSFEESPQGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSN
MVIGWFKLFPPSSLVDPTLAPLTRRASQSSLESSTGPSYSRS
NT seq 4449 nt   +upstreamnt  +downstreamnt
atgtcggctcctgtcgggccgcggggccgcccggctcccgctccggcagcctctcagccg
cctctgcagcccgagatgcccgacctcagccacctcacggaggaggaaaggaaaatcatt
ctggccgtcatggatcggcagaagaaagaagaggagaaggagcagtcggtgctcaagatc
aaagaagaacacaaaccacaactgacacagtggtttccctttagtgggatcactgaactg
gtaaataacgttcttcagccccagcaaaaacaacaaaatgaaaaggagccccagacaaaa
cttcatcaacagttcgaaatgtataaggagcaggtaaagaagatgggagaagaatcacag
cagcagcaggaacagaagggtgatgccccaacctgtggtatttgccacaaaacaaagttt
gctgatggatgtggccataactgttcatattgccaaacaaagttttgcgctcgttgtgga
ggtcgagtgtcattacgctcaaacaaggaggacaaagtggttatgtgggtatgtaatttg
tgccgaaaacaacaagaaatcctcactaaatcaggagcgtggttttataatagtggatct
aatacaccacagcaacctgatcaaaaggttctccgaggaatgcggaatgaggaggcacct
caggagaagaaagcaaaactgcatgagcaggcccagttccaaggaccctcaggtgactta
tctgtacctgcagtggagaaaagtcgatctcatgggctcacaagacaggattctattaaa
aatgggtcaggagtcaagcaccaaattgccagtgacatagcttcagacaggaaaagaagt
ccatcagtgcccagagatcagaatagaagatacgaccaaagagaagaaagagaggaatat
tcacagtatgctacttcagatagcgcaatgcctagatctccatcagattatgctgatagg
aggtctcagcgtgaacctcagttttatgaagagtctgaccatatgaattatagggactcc
aacaggagaagtcataggcattccaaagaatatattgtagatgatgaggatgtggagagt
agagatgaatatgaaagacaaaggagagaggaggaataccagtcacgttatcgaagtgat
ccaaatttggcccgttatccagtaaagccacagccatatgaagagcaaatgcgtattcat
gccgaagtgtccagagcacggcatgaaagaagacatagtgatgtttctttggcaaatgcc
gaactggatgattccaggatttctatgctaaggatggaacgaccatccaggcaaaggtct
atatctgaacgtagagctgctatggaaaatcagcgatcttattcaatggaaagaactcga
gaggctcagggaccaacttcttatccacaaaggaccacaaaccatagtcctcccacccct
cggaggagtccaatacccattgatagacaagacatgagacgtactgactcactaaggaaa
caacaccacttagatcctagctctgctgtgaggaaaacaaaaagggaaaaaatggaaacg
atgttaaggaatgattctctcagttctgaccagtcagagtcagtgagacctccaccaccg
aagcctcataaatcaaagaaaggtggtaaaatgcgccaggtttcattgagcagttcagag
gaggaattggcttccacacctgaatatacaagttgtgaggatgtggagattgaaagtgag
agtgtcagtgaaaaaggggacagtcaaaagggaaaaagaaaaactagtgagcaggcagtt
ttgtcggattctaacaccaggtccgagagacaaaagaaaatgatgtactttggtggccac
tctttggaagaggatttggaatggtctgagccccagattaaggactctggggtagatacg
tgtagtagcacaacccttaacgaggagcatagccatagcgataagcaccctgtgacatgg
caaccatctaaagatggagatcgtttaattggtcgcattttattaaataagcgtctaaaa
gatggaagtgtacctcgagattcaggagcaatgcttggcttgaaggttgtaggaggaaag
atgactgaatcaggtcggctttgtgcatttattaccaaagtaaaaaaaggaagtttagca
gatactgtagggcatcttagaccaggcgatgaagtgttagaatggaatggaaggctattg
caaggagccacatttgaagaagtatataatatcattctggaatccaaacctgaaccacaa
gtggagcttgttgtttcaaggcctattggagatatacctagaatacctgatagcacacat
ccacaactggagtccagttctagctcatttgaatctcaaaaaatggatcgtccttctatt
tccgttacctctcccatgagtcctggcatgttgagggatgttccacagttcttatctgga
caactttcaagccaaagccttagtagaagaacaacgccttttgttcctagggttcagata
aaactatggtttgacaaggttggtcaccaattaatagttacaattttgggagcaaaggat
ctcccttccagggacgatgggaggccaaggaacccttatgttaaaatttactttcttcca
gacagaagtgataaaaacaagagaagaactaaaactgtaaagaaaacattggaacccaaa
tggaaccaaacattcatttactctccagtccaccgaagagaatttcgggaacgaatgttg
gagattactctttgggatcaagcacgagttcgagaagaggaaagtgaattcttaggagag
attttaattgaattagaaacagcattattagatgacgagccacattggtacaaacttcag
acccatgatgtttcttcattgccacttccacatccttctccatacatgccacgacgacag
cttcatggagaaagcccaacacggaggttgcaaaataaagccttatgttcatataattca
gggtcgaagagaataagtgatagtgaagtctctgactatgactgtgatgatggaattgga
gtagtatcagattatcgacacaatggtcgagatcttcaaagctcaacattatcagtgcca
gaacaagtaatgtcatcaaaccattgttcaccatcagggtcccctcaccgagtagatgtt
ataggaaggacaaggtcatggtcacccagtgtccctcctccacaaagtcggaatgtggaa
cagggacttcgagggacacgctccactactggacattataacacaattagccgaatggat
agacatcgtgtcatggatgaccattattctccagatagagacagtcattttcttactcta
cctcgctccagatacagtcagaccactgaacatcatcacagggatggcagggattgtgaa
gcagcagatagacagccatatcacagatccagatcagcagaacagcggcctctcctagag
cggaccaccacccgctccagatccactgaacgtcctgatacaaacctcatgaggtcgatg
ccttcattaatgactggaagatctgcccctccttcacctgccttatcgaggtctcatcct
cgtactgggtctgtccaaacaagcccatcaagtacaccagtggcaggacgaaggggccga
caacttccacagcttccgccaaagggaacattggagagaaacaatggagtcaaggagata
gaaccttatgaagaagcaggaggtaaaaagctccggagcactgtccaaagaagtacagag
acgggcctggctgtggaaatgaggaactggatgactcggcaggccagccgagagtccaca
gatggcagcatgaacagctatagctcagaggggaatctgattttccctggtgttcgtttg
gcctctgatagccagttcagcgattttctggatggccttggccctgcccagctagtgggg
cgtcagactctggctacacctgcaatgggtgacattcaggtaggaatgatggacaaaaag
ggacagttggaggtggaaatcattcgggcccgtggcctcgttgtaaaaccaggttccaag
acactgccagcaccgtatgtaaaggtgtatctgttagataacggagtctgcatagccaaa
aagaaaacaaaagtggcaagaaaaacgctggaacccctttaccagcagctgttatctttc
gaagagagcccccaagggaaggttttacagatcattgtctggggagattacggccgcatg
gatcacaaatctttcatgggagtggcccagatacttttagatgaactggagctatccaat
atggtgattggatggttcaaactcttccccccttcctccctagtagatccaaccttggcc
cctctgacaagaagagcttcccagtcatccctggaaagttcaaccggaccttcctactct
cgttcatag

DBGET integrated database retrieval system