KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512308
Entry
107512308         CDS       T06036                                 

Gene name
KCNN4
Definition
(RefSeq) intermediate conductance calcium-activated potassium channel protein 4 isoform X1
  KO
K04945  potassium intermediate/small conductance calcium-activated channel subfamily N member 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04911  Insulin secretion
ray04929  GnRH secretion
ray04970  Salivary secretion
ray04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107512308 (KCNN4)
   04929 GnRH secretion
    107512308 (KCNN4)
  09154 Digestive system
   04970 Salivary secretion
    107512308 (KCNN4)
   04974 Protein digestion and absorption
    107512308 (KCNN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107512308 (KCNN4)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107512308 (KCNN4)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 N-SET
Other DBs
NCBI-GeneID: 107512308
NCBI-ProteinID: XP_016003197
LinkDB
Position
Unknown
AA seq 452 aa
MAALCVLRGGEPWAGSWLSPKTPGAMGGKLVTGLGALRRRKRLLEQERWLAGWALTLAGI
GIGLMVLHAEMLWFGGCPWALYLFLVKCIISISTFFLLCLIVAFHAKEVQLFMTDNGLRD
WRVALTRRQVAQILLELAVCGLHPVPVRGPPCALGTQSPSTATQSWPGFLDQGEALLSLA
MLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLCLTLGL
WLTTAWVLSVAERQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGV
CCTALLVAVVARKLEFNKAEKHVHNFMMDIQYAKEMKESAARVLQEAWMFYKHTRRKDAR
AARRHQRRLLAAINTFRQVRLKHRKLREQVNSMVDISKMHMILCDLQLGLNSSHQALEKR
IDALAGKLDTLTELLSTALGPQQPPELSQEAT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggctgccctttgcgtgctgcgaggtggggaaccctgggcaggaagctggctgagcccc
aagaccccgggggccatgggcgggaagctggtgaccggcctgggggccctgcggcggcga
aagcgcctgctggagcaggagcggtggctggccggctgggcgctgacgctggcgggaatt
ggcatcgggctcatggtactgcacgcggagatgctgtggttcgggggctgcccgtgggcg
ctctacctgttcctggttaaatgcatcatcagcatttccaccttcttcctcctctgcctc
atcgtggcctttcacgccaaagaggtccagctgttcatgaccgacaacgggctccgggac
tggcgcgtggcactgacccgacggcaggtggcgcagatcctgctggagctggcggtgtgc
ggactgcacccggtgccggtgcggggcccgccctgcgcgctgggtacccagtccccgtcg
acggcgacgcagtcctggccggggttcctggaccagggagaggcgctgctgtcactggcc
atgctgctgcgcctctacctggtgccccgcgccgtgctcctgcgcagcggcgtcctgctc
aacgcgtcctaccgcagcatcggcgccctcaaccaggtccgcttccgccactggttcgtg
gccaagctgtacatgaacactcaccccggccgcctgctgctctgcctcacgctcggcctc
tggctcaccaccgcctgggtgctgtcggtggcagagaggcaggccgttaatgccactgga
cacctttcggacacactgtggctgatccccatcacattcctgaccattggctacggggac
gtggtgccgggcaccatgtggggcaagattgtctgcctctgcactggggtaatgggggtc
tgctgcacagccctgctggtggctgtagtggctcggaagctggagtttaataaagcagag
aagcacgtgcacaacttcatgatggacatccagtatgccaaagagatgaaagagtcggct
gcccgagtgctacaagaggcctggatgttctataaacacacacgcaggaaggacgccaga
gctgcccgcaggcaccagcgcaggctgctggccgccatcaacacgttccgccaggtgcgg
ctgaaacaccgaaagctccgggaacaagtgaactccatggtggacatctccaagatgcac
atgatcctgtgtgacttgcaactgggtctgaatagctcacaccaggccttggagaagcgg
attgacgcactggcagggaagctggacaccctgacggagctgctcagcactgccctgggg
ccacagcagcctccagaactcagccaggaggccacgtag

DBGET integrated database retrieval system