KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512383
Entry
107512383         CDS       T06036                                 

Gene name
GCK
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00010  Glycolysis / Gluconeogenesis
ray00052  Galactose metabolism
ray00500  Starch and sucrose metabolism
ray00520  Amino sugar and nucleotide sugar metabolism
ray00524  Neomycin, kanamycin and gentamicin biosynthesis
ray01100  Metabolic pathways
ray01200  Carbon metabolism
ray04910  Insulin signaling pathway
ray04911  Insulin secretion
ray04917  Prolactin signaling pathway
ray04922  Glucagon signaling pathway
ray04930  Type II diabetes mellitus
ray04950  Maturity onset diabetes of the young
ray05230  Central carbon metabolism in cancer
Module
ray_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ray_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
ray_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107512383 (GCK)
   00052 Galactose metabolism
    107512383 (GCK)
   00500 Starch and sucrose metabolism
    107512383 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    107512383 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107512383 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107512383 (GCK)
   04910 Insulin signaling pathway
    107512383 (GCK)
   04922 Glucagon signaling pathway
    107512383 (GCK)
   04917 Prolactin signaling pathway
    107512383 (GCK)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    107512383 (GCK)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107512383 (GCK)
   04950 Maturity onset diabetes of the young
    107512383 (GCK)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     107512383 (GCK)
SSDB
Motif
Pfam: Hexokinase_2 Hexokinase_1
Other DBs
NCBI-GeneID: 107512383
NCBI-ProteinID: XP_016003340
LinkDB
Position
Unknown
AA seq 601 aa
MVSCRDVTFPKQRETQTSSEPALCPIAGRESEQETGQRGQHAHSPRPGPGGVGSSSRWPG
SSPFGIIPTSYVVPFCVKQRGQHKHRASSAPGSAVDVRRKQPARVRAPQLQAVRRAKPRQ
GPRLPVTGALAGVWMGNRAQRGHRRPPGRSEAEQILAEFRLQEEDLKKVMRRMQKEMDRG
LRLATHEEASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEAGQWSLNTK
HQMYSIPEDAMTGTAEMLFDYVSECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGIL
LNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRQCEVGM
IVGTGCNACYMEEMHNVELVDGDEGRMCVNTEWGAFGDAGELDEFLLEYDRMVDESSLNP
GQQLYEKLISGKYMGELVRLVLLKLVDEDLLFRGEASEQLRTRGAFETRFVSQVESDSGD
RKQIYNILSTLGLRPSATDCDIVRRACESVSTRAAHMCGAGLAGVINRMRESRSEDVMRI
TVGVDGSVYKLHPSFKERFHAIVRRLTPSCEITFIQSEEGSGRGAALVSAVASKKACMLG
Q
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggtgagctgcagagatgttacctttccaaaacaaagagaaacccagacatcatctgag
ccagccctgtgccctatagcaggcagggagagtgagcaggagacagggcagaggggacag
catgcccacagccccaggccagggccaggtggagtgggcagctcaagcaggtggccgggg
tccagtccctttggcataattcccacctcatacgtcgtgcctttctgtgtgaaacaacga
ggtcagcacaaacaccgggctagttccgctcccggtagtgccgttgatgtcaggaggaag
cagccagcccgggtcagggcgccacagctgcaggcagtgaggcgggccaaaccccggcaa
ggcccacgtctgccagtcactggggctctggcgggagtttggatgggaaatcgtgcacaa
aggggccacaggaggccacctgggagaagcgaggccgagcagatcctggcggagttcagg
ctgcaggaggaggatctgaagaaggtgatgaggcggatgcagaaggagatggaccgaggc
ctgaggctggcgactcacgaggaggccagcgtgaagatgctgcccacctacgtgcgctcc
acccccgaaggctcagaagtcggggacttcctctccctggacctgggtggcaccaacttc
agggtgatgctggtgaaggtgggggagggcgaggcagggcagtggagcctgaacaccaag
caccagatgtactccatccccgaggacgccatgacgggcaccgccgagatgctcttcgac
tatgtctccgagtgcatctccgacttcctggacaagcaccagatgaagcacaagaagctg
cccttgggcttcaccttctccttccccgtgcggcacgaggacatcgacaagggcatcctt
ctcaactggaccaagggcttcaaggcttctggggcagaagggaacaacgttgtggggctc
ctgcgagacgccatcaagcggagaggggactttgagatggacgtggtggccatggtgaat
gacaccgtggccacaatgatctcctgctactacgaagaccgccagtgtgaggttggcatg
atagtgggcacgggctgcaacgcttgttacatggaggaaatgcacaacgtggagctggtg
gatggggacgagggccgcatgtgcgtcaacaccgagtggggggcctttggggacgcaggc
gagctggacgagttcctgctggagtacgaccggatggtggacgagagctcgctcaacccg
ggccagcagctgtatgagaagctcatcagcggcaagtacatgggcgagctggtgcggctc
gtgctgctcaagctggtggacgaggacctgctcttccgcggcgaggcctcggagcagctg
cgcacgcgcggcgccttcgagacccgcttcgtgtcgcaggtggagagcgactcaggcgac
cgcaagcagatctacaatatcctgagcacgctggggctgaggccctcggccactgactgc
gacatcgtgcgcagagcctgcgagagtgtgtccacgcgcgccgcgcacatgtgcggcgcg
gggctggcgggcgtcatcaaccgcatgcgcgagagccgcagcgaggacgtgatgcgcatc
accgtgggcgtggacggctcggtgtacaagttgcaccccagcttcaaggagcggttccat
gccattgtgcgcaggctgacccccagctgcgagatcaccttcatccagtcggaggagggc
agtggccggggcgcagctctggtctccgccgtcgcctctaagaaggcctgcatgctgggc
cagtga

DBGET integrated database retrieval system