KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512530
Entry
107512530         CDS       T06036                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04630  JAK-STAT signaling pathway
ray04640  Hematopoietic cell lineage
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107512530 (IL3RA)
   04151 PI3K-Akt signaling pathway
    107512530 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107512530 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107512530 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107512530 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512530 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ray04050]
    107512530 (IL3RA)
   04090 CD molecules [BR:ray04090]
    107512530 (IL3RA)
Cytokine receptors [BR:ray04050]
 Interleukin receptor families
  IL3 receptor family
   107512530 (IL3RA)
CD molecules [BR:ray04090]
 Proteins
  107512530 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind
Other DBs
NCBI-GeneID: 107512530
NCBI-ProteinID: XP_016003662
LinkDB
Position
Unknown
AA seq 444 aa
MQRESARASLHTGPLDLVTRRRPALALVVRGGPPGPRAIKSPSWEKQLCCCWLPPAQGAH
AGRQDPRDPQASAGRGASLTCTRLCTADPDAPIKNVRMEAARKMLTWDVTGNVSEIRCSR
NGAFSVRARNNRYCQFHVLMRCEASNYTVTVTLRDGSVFSTWTQYPKQEGEPESAARHLE
CRVHNVHLLTCGWQVGRAAPRDVQYHLYLENVKTHQRWPCPRYAADERGTRTQCRFSNIS
GFADAAQHRFVVNGTSKDAAVRCSERVTLLADIEKLSPPNMTASCNQSNSIMTWKMSSLF
QTDFNYELEIRKGADAPYTEVLWETSFVLQSPRAYTARIRALVSGQSPGEWSAPQRFECD
QEEDARLHVWVILSVTAVATLLTVGVAVLLYKGCSVRQRLFPPIPQMKDPLGDNAHTEKM
MTWESSRAGQEECPVAAVQVLGEA
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgcagagagagagcgcgcgcgcgagcctgcacacggggccgcttgacctggtcactcgc
cgcaggccggcgctggcgctggtggttaggggcgggccgcccgggccccgcgctataaaa
agcccgagctgggaaaagcagctttgttgctgttggcttcctccagcgcagggagcgcac
gctgggcggcaggacccgcgggacccccaggccagcgcggggcggggagcctcactcacc
tgcactcggctctgcaccgcagatcccgacgcgccgattaagaacgtgaggatggaggcg
gcgcggaaaatgctcacctgggacgtcaccggcaacgtctcggagattcggtgctccaga
aacggggccttcagcgtgagggcaagaaacaaccgttactgccagtttcacgtgctcatg
aggtgcgaggcgtcaaactacacggtcaccgtcaccctgcgcgacggctccgtgttctcc
acgtggactcagtacccgaagcaagagggggagcccgagtcggccgcccgacacctggag
tgccgggtgcacaacgtgcacctgctgacgtgcggctggcaggtgggccgggcggccccg
agggacgtccagtaccacctgtacctggagaacgtgaagacccaccagcggtggccgtgt
ccacggtacgcggccgacgagcggggcacccgcacccagtgccggttcagcaacatctcc
ggcttcgccgacgccgcccagcaccgctttgtggtgaacggcaccagcaaggacgccgcg
gtacgctgctcggaacgcgtcacacttttggctgacatcgagaaactgagtccgcccaac
atgacggccagctgtaatcagtccaactccatcatgacatggaagatgtcaagcctcttc
caaacggacttcaactatgaacttgaaatacgaaagggcgcagacgccccctacacagag
gtcctctgggagacgtccttcgtgctgcagagcccgcgtgcgtacacggcgaggatcaga
gcgctggtctccggccagagccccggagagtggagcgcgccccagcgcttcgagtgcgac
caggaggaggacgcgcgcctgcacgtctgggtgatcctgtcggtgaccgcggtggccacg
ctgctgactgtgggagtcgccgtcctgctctataaagggtgctccgtgcggcagaggctc
ttccctcccatcccccaaatgaaagaccccctcggcgacaacgctcacactgagaagatg
atgacctgggagagcagcagagccggccaagaggagtgtcccgtggctgccgtgcaggtc
ttgggcgaagcgtga

DBGET integrated database retrieval system