KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512578
Entry
107512578         CDS       T06036                                 

Gene name
SLC32A1
Definition
(RefSeq) vesicular inhibitory amino acid transporter
  KO
K15015  solute carrier family 32 (vesicular inhibitory amino acid transporter)
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04721  Synaptic vesicle cycle
ray04723  Retrograde endocannabinoid signaling
ray04727  GABAergic synapse
ray05032  Morphine addiction
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107512578 (SLC32A1)
   04723 Retrograde endocannabinoid signaling
    107512578 (SLC32A1)
   04721 Synaptic vesicle cycle
    107512578 (SLC32A1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107512578 (SLC32A1)
   05033 Nicotine addiction
    107512578 (SLC32A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107512578 (SLC32A1)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC32: Vesicular inhibitory amino acid transporter
   107512578 (SLC32A1)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 107512578
NCBI-ProteinID: XP_016003745
LinkDB
Position
Unknown
AA seq 526 aa
MATLLRSKLTNVATSVSNKSQAKVSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQM
DILKTEGEPCGDEGSEPPVEGDIHYQRGGGAPLPPSGSKDQAVGAGGEFGGHDKPKITAW
EAGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEV
VRVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVS
QKSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKF
YIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAY
LTWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFP
ACYGGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLR
LLWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggccaccctgctccgcagcaagctgaccaatgtggccacgtccgtgtccaacaagtcc
caggccaaggtgagcggcatgttcgccaggatgggttttcaggcggccacggacgaggaa
gcggtgggcttcgcgcactgcgacgacctcgactttgagcaccgtcagggcctgcagatg
gacattctgaaaaccgagggcgagccctgcggggacgagggctccgaaccgcccgtcgag
ggagacattcattaccagcgcggcggcggcgcgcccctgccgccctcgggctccaaggac
caggccgtgggagctggtggcgagttcgggggccacgacaaacccaaaatcacggcatgg
gaggcgggctggaacgtgaccaacgctatccagggaatgtttgtcctgggcctgccctac
gccatcctgcacggcggctacctggggttgtttcttatcatcttcgccgccgtggtgtgc
tgctacactggcaagatcctcatcgcatgcctatacgaggagaacgaggacggcgaggtg
gtgcgggtgcgggactcatacgtggccatcgccaacgcgtgctgcgctccgcggttcccc
acgttgggcggccgcgtggtgaacgtggcacagatcatcgagctggtgatgacctgcatc
ctatacgtggtggtgagcggcaacctcatgtacaacagcttcccggggctacccgtgtcg
cagaagtcctggtctatcatcgccacggcggtactgctgccctgcgccttcctgaagaat
ctcaaggccgtgtccaagttcagcctgctgtgcactttggcccacttcgtcatcaatatc
ctggtcattgcctactgcctatcgcgagcgcgcgactgggcctgggagaaggtcaagttc
tatatcgacgtaaagaagtttcccatttccattggcatcatcgtgttcagctacacatcg
cagatcttcctgccttcgctggagggtaacatgcaacagcccagcgagttccattgcatg
atgaactggacgcacatcgccgcctgcgtactcaaaggcctcttcgcgctcgtcgcctac
ctcacctgggccgacgagacaaaggaagtcatcacggataacctgcccggttccatccgc
gctgtggtcaacatcttcctggtggccaaggccttgttgtcatacccgctgcccttcttc
gctgccgtggaggttctggagaagtcgctcttccaggaaggcagccgcgccttcttccct
gcctgctacggcggcgacggccggctcaaatcgtgggggctgacgctgcgctgcgcgctg
gtcgtcttcacgctgctcatggctatctatgtgccgcacttcgcgctgctcatgggcctc
acgggcagcctaaccggagccggcctctgcttcctgctgcccagcctcttccacctgcgc
ctgctctggcgcaagctgctgtggcaccaagtcttcttcgacgtcgccatcttcgtcatc
ggcggcatctgtagcgtctccggcttcgtgcactcgctcgagggcctcatcgaggcctac
cgaaccaacgcggaggactag

DBGET integrated database retrieval system