KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512598
Entry
107512598         CDS       T06036                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04015  Rap1 signaling pathway
ray04062  Chemokine signaling pathway
ray04137  Mitophagy - animal
ray04144  Endocytosis
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04520  Adherens junction
ray04530  Tight junction
ray04540  Gap junction
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04625  C-type lectin receptor signaling pathway
ray04727  GABAergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04810  Regulation of actin cytoskeleton
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray05100  Bacterial invasion of epithelial cells
ray05135  Yersinia infection
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05219  Bladder cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107512598 (SRC)
   04015 Rap1 signaling pathway
    107512598 (SRC)
   04370 VEGF signaling pathway
    107512598 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107512598 (SRC)
   04137 Mitophagy - animal
    107512598 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107512598 (SRC)
   04520 Adherens junction
    107512598 (SRC)
   04530 Tight junction
    107512598 (SRC)
   04540 Gap junction
    107512598 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107512598 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107512598 (SRC)
   04613 Neutrophil extracellular trap formation
    107512598 (SRC)
   04625 C-type lectin receptor signaling pathway
    107512598 (SRC)
   04062 Chemokine signaling pathway
    107512598 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107512598 (SRC)
   04915 Estrogen signaling pathway
    107512598 (SRC)
   04917 Prolactin signaling pathway
    107512598 (SRC)
   04921 Oxytocin signaling pathway
    107512598 (SRC)
   04926 Relaxin signaling pathway
    107512598 (SRC)
   04919 Thyroid hormone signaling pathway
    107512598 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    107512598 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107512598 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    107512598 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107512598 (SRC)
   05203 Viral carcinogenesis
    107512598 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    107512598 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107512598 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107512598 (SRC)
   05152 Tuberculosis
    107512598 (SRC)
   05100 Bacterial invasion of epithelial cells
    107512598 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107512598 (SRC)
   05168 Herpes simplex virus 1 infection
    107512598 (SRC)
   05163 Human cytomegalovirus infection
    107512598 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107512598 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107512598 (SRC)
   01522 Endocrine resistance
    107512598 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107512598 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107512598 (SRC)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107512598 (SRC)
Protein kinases [BR:ray01001]
 Non-receptor tyrosine kinases
  SRC family
   107512598 (SRC)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    107512598 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    107512598 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107512598 (SRC)
  Macropinocytosis
   Kinases
    107512598 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 107512598
NCBI-ProteinID: XP_016003780
LinkDB
Position
Unknown
AA seq 553 aa
MGSNKSKPKDASQRRRSLEPAENAHGAGGGAFPTSQTPSKPASADGHRGPNAAFSPAASE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKV
DVSQTWFTFRWLQREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESER
LLLNTENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQF
NSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGE
VWMGTWNGTTRVAIKTLRPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEY
MSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVC
KVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGR
VPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYF
TSTEPQYQPGENL
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggacgccagccagcggcgccgcagcctggagcct
gccgagaacgcccacggtgcgggcgggggcgccttccccacctcacagacccccagcaag
ccggcctccgctgatggccaccgcggccccaacgcggccttcagccccgcggcctccgag
cccaagctcttcgggggcttcaactcctcggacacagtcacctccccgcagagggcgggg
ccgctggctgggggagtgaccacctttgtggctctctatgactatgagtcgcggacagag
accgacctatccttcaagaaaggggagcggctccagattgtcaacaacacgaggaaggtg
gatgtcagccagacctggttcacattcagatggctacaaagagagggagactggtggctt
gcccactcgctcagcaccggacagacgggctacatccccagcaactacgtggcgccctct
gactccatccaagccgaggagtggtactttggcaagatcaccagacgggagtcagagcgg
ttactgctcaacacggagaacccgagagggaccttcctagtgcgagaaagcgagaccacg
aaaggtgcctactgcctctcagtttctgacttcgacaatgccaagggcctcaacgtgaag
cactacaagatccgcaagctggacagcggcggcttctacatcacctctcgcacccagttc
aacagtctgcagcagctcgtagcctactactccaaacatgccgacggcctgtgccaccgc
ctcaccactgtgtgccccacatccaagccgcagactcaggggctggccaaggatgcctgg
gagatcccccgggagtcactgcggctggaggtcaagctgggccagggctgctttggagag
gtgtggatggggacctggaatggcaccaccagggtggccatcaaaaccctgaggccaggc
acgatgtctccagaggccttcctgcaggaggcccaggtgatgaagaaactgaggcacgag
aagctggtgcagctgtacgcggtggtgtctgaggagcccatctacatcgtcacggagtac
atgagcaaggggagtttgctggactttctcaagggagagacaggcaagtacctgcggctg
cctcagctggtggacatggctgctcagattgcctcaggcatggcatacgtggagcggatg
aactacgtccaccgggacctccgagctgccaacatcctggtcggagagaacctcgtgtgc
aaagtagctgatttcgggctggctcggctcatcgaagacaatgaatacacagcccggcaa
ggtgccaaattccccatcaagtggacggctccagaagccgccctctatggccggttcacc
atcaagtcggacgtgtggtcctttgggatcctgctgacagagcttacaacaaagggacga
gtgccctaccctgggatggtaaaccgagaggtgctggatcaggtggagcggggctaccgg
atgccctgcccgcctgagtgtcctgagtccctgcacgacctcatgtgccagtgctggcgg
aaggagccagaggaacggcccaccttcgagtacctacaggcctttctggaggactatttc
acatccaccgagccccagtatcagcctggagagaacctatag

DBGET integrated database retrieval system