KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512613
Entry
107512613         CDS       T06036                                 

Gene name
MYL9
Definition
(RefSeq) myosin regulatory light polypeptide 9
  KO
K12755  myosin regulatory light chain 9
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04270  Vascular smooth muscle contraction
ray04360  Axon guidance
ray04510  Focal adhesion
ray04530  Tight junction
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray04921  Oxytocin signaling pathway
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107512613 (MYL9)
   04022 cGMP-PKG signaling pathway
    107512613 (MYL9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107512613 (MYL9)
   04530 Tight junction
    107512613 (MYL9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107512613 (MYL9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107512613 (MYL9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107512613 (MYL9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107512613 (MYL9)
  09158 Development and regeneration
   04360 Axon guidance
    107512613 (MYL9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107512613 (MYL9)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107512613 (MYL9)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   107512613 (MYL9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 107512613
NCBI-ProteinID: XP_016003830
LinkDB
Position
Unknown
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagtaagcgggctaaggccaagaccaccaagaagcggccacagcgggccacatcc
aatgtcttcgcaatgtttgaccagtcccagatccaggagtttaaggaggccttcaacatg
atagaccagaaccgagatggcttcattgacaaggaggacttgcatgacatgctggcctca
ctgggaaagaaccccacggatgagtacctggagggcatgatgagcgaggccccggggccc
atcaacttcaccatgttcctgaccatgtttggggagaagctgaatggcacagaccccgag
gacgtgatccgcaatgccttcgcctgctttgatgaggaggcctcaggttttatccacgag
gaccatcttcgggagctgcttaccaccatgggtgaccgcttcacagacgaggaagtggac
gagatgtaccgtgaggcacccattgataagaaaggcaacttcaactatgtggagttcacc
cgcatcctcaaacatggtgccaaggacaaagacgactag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521248
Entry
107521248         CDS       T06036                                 

Gene name
MYL6B
Definition
(RefSeq) myosin light chain 6B
  KO
K12751  myosin light chain 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04270  Vascular smooth muscle contraction
ray04530  Tight junction
ray04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107521248 (MYL6B)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107521248 (MYL6B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107521248 (MYL6B)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107521248 (MYL6B)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107521248 (MYL6B)
  Exosomal proteins of bladder cancer cells
   107521248 (MYL6B)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_9
Other DBs
NCBI-GeneID: 107521248
NCBI-ProteinID: XP_016021261
LinkDB
Position
Unknown
AA seq 209 aa
MPPKKDVPVKKPAGPSISKPAAKPVAGAPLGKTKAEPTAAVPSAPEKTREPPIDLSKVVI
EFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKS
RRVDFETFLPMLQAVAKNRDQGTYEDYLEGLRVFDKEGNGKVMGAELRHVLTTLGEKMTE
EEVETVLAGHEDSNGCINYEAFLKHILSV
NT seq 630 nt   +upstreamnt  +downstreamnt
atgcctcccaagaaggatgttcctgtgaagaaaccagcagggccctctatctccaagcct
gctgccaagccagtagcaggggcccctctaggcaagaccaaggctgagccaacagcagct
gtcccttcagcccctgagaaaacccgggagccccctatcgatctctccaaagtggtgatc
gagtttaacaaggaccagctggaggagttcaaggaggcctttgagctgtttgaccgagta
ggggatggcaagatcctgtacagccagtgtggggatgtgatgagagccctgggccagaac
cctaccaacgccgaggtgctcaaggttctggggaaccccaagagtgatgagctaaagtcc
cggcgtgtggactttgagactttcctgcccatgctccaggcggtggccaagaaccgggac
caaggcacatatgaggactacctggaggggcttcgggtgtttgacaaagaagggaatggc
aaagtcatgggagcagagctcagacatgtcctcaccaccctgggagagaagatgactgaa
gaggaagtggagactgttctggcaggacatgaagacagcaatggctgcatcaactatgaa
gcctttctgaagcacatcctaagcgtctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521249
Entry
107521249         CDS       T06036                                 

Gene name
MYL6
Definition
(RefSeq) myosin light polypeptide 6 isoform X1
  KO
K12751  myosin light chain 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04270  Vascular smooth muscle contraction
ray04530  Tight junction
ray04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107521249 (MYL6)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107521249 (MYL6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107521249 (MYL6)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107521249 (MYL6)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107521249 (MYL6)
  Exosomal proteins of bladder cancer cells
   107521249 (MYL6)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_9
Other DBs
NCBI-GeneID: 107521249
NCBI-ProteinID: XP_016021262
LinkDB
Position
Unknown
AA seq 151 aa
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM
NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM
TEEEVEMLVAGHEDSNGCINYEELVRMVLNG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtgtgacttcaccgaggaccagactgcagagttcaaggaggcctttcagctgtttgac
cggacaggggatggcaagatcctgtacagccagtgtggggatgtgatgagggccctgggc
cagaaccccaccaatgccgaggtgctcaaagtcctggggaaccccaaaagtgatgagatg
aatgtgaaggtgttggactttgagcacttcctgcccatgctgcagactgtggccaagaac
aaagaccagggcacctatgaggactatgtcgaaggcctcagggtatttgacaaggaagga
aatggtactgtcatgggcgctgagatccgtcatgttcttgtcacactgggtgaaaagatg
acagaggaagaagtagagatgctggtggcagggcatgaggacagcaatggttgtatcaac
tatgaagagctcgtccgcatggtgctgaatggctga

DBGET integrated database retrieval system