KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512674
Entry
107512674         CDS       T06036                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04115  p53 signaling pathway
ray04120  Ubiquitin mediated proteolysis
ray04144  Endocytosis
ray04151  PI3K-Akt signaling pathway
ray04218  Cellular senescence
ray04625  C-type lectin receptor signaling pathway
ray04919  Thyroid hormone signaling pathway
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107512674 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107512674 (MDM2)
   04151 PI3K-Akt signaling pathway
    107512674 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107512674 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    107512674 (MDM2)
   04115 p53 signaling pathway
    107512674 (MDM2)
   04218 Cellular senescence
    107512674 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107512674 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107512674 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512674 (MDM2)
   05202 Transcriptional misregulation in cancer
    107512674 (MDM2)
   05206 MicroRNAs in cancer
    107512674 (MDM2)
   05205 Proteoglycans in cancer
    107512674 (MDM2)
   05203 Viral carcinogenesis
    107512674 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    107512674 (MDM2)
   05220 Chronic myeloid leukemia
    107512674 (MDM2)
   05218 Melanoma
    107512674 (MDM2)
   05219 Bladder cancer
    107512674 (MDM2)
   05215 Prostate cancer
    107512674 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107512674 (MDM2)
   05169 Epstein-Barr virus infection
    107512674 (MDM2)
   05165 Human papillomavirus infection
    107512674 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107512674 (MDM2)
   01522 Endocrine resistance
    107512674 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107512674 (MDM2)
   04121 Ubiquitin system [BR:ray04121]
    107512674 (MDM2)
Enzymes [BR:ray01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107512674 (MDM2)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    107512674 (MDM2)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    107512674 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 DUF1229 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 107512674
NCBI-ProteinID: XP_016003948
LinkDB
Position
Unknown
AA seq 492 aa
MCNTSMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMNKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQEPSDSGI
PVSENSCHLEGGSDEKDPVQELQEEKPSSSDSVSRPSPSSRRRTISETEDNSDELPGERQ
RKRHKSDSISFSFDENLALCVIREIRCERNSSSESTGTSSNPDLDAGVSEHSGDWLDQDS
VSDRFSVEFEVESFNSEDYNLSEEGQELSDEDDEVYQVTVYQAEESDTDSFEDDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKGKEKGKMAEETELENSVQVEEGFDVP
DCKKNTTVYDSRESCVEENDEKITQASQSQESEDYSQPSTSSSIIYSSQEDVKELEKEET
QDKEESVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCR
QPIQMIVLTYFS
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgtgcaataccagcatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcagaacaagagaccctggttagaccaaagccattacttttgaagttgttgaaatct
gttggtgcacaaaaagacacttacactatgaaagaggttatattttatcttggccagtat
attatgaataaacgattatatgatgagaagcaacagcatattgtatattgttcaaatgat
cttctaggggatttgtttggagtgccaagcttctctgtgaaagaacacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcaacaggaaccatcagattcaggcata
cccgtgagtgaaaacagttgtcatcttgaaggtgggagtgatgaaaaggaccctgtgcaa
gagctacaagaagaaaaaccttcatcttcagattcggtttctagaccatctccctcatct
agaaggagaacaattagtgagacagaggacaattcagatgaactacctggtgaacgacaa
agaaagcgccacaaatctgatagtatttccttttcctttgatgaaaaccttgctctttgt
gtaataagggagatacgttgtgaaagaaacagtagcagtgaatcaacagggacttcatca
aatccggatcttgatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcgattcagtgtagaatttgaagttgagtctttcaattcagaagattataac
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcaagttactgtg
tatcaggcagaggagagtgatacagattcatttgaagacgaccctgaaatctccttagct
gactattggaagtgcacttcatgcagtgaaatgaatcctccccttccaccacattgcaac
agatgctgggcccttcgtgagaattggcttcctgaagacaaagggaaagaaaaagggaaa
atggctgaggaaactgaacttgaaaactcagtacaagtagaagagggctttgatgtccct
gattgtaaaaaaaatactacagtgtatgattcccgagaatcatgtgttgaggaaaatgat
gaaaagatcacacaagcctcccaatcccaagaaagtgaagactattctcagccatcaact
tctagtagcattatttatagcagccaagaagatgtcaaagagttagagaaggaagaaaca
caagacaaagaagaaagtgtggagtctagttttccacttaatgctatcgaaccttgtgtg
atttgccaaggtcgacctaaaaatggttgcatcgtccatggcaaaacaggacatcttatg
gcatgttttacgtgtgcaaagaagctaaagaaaaggaataagccctgcccagtgtgtaga
caaccaattcaaatgatcgtgttaacttatttctcctag

DBGET integrated database retrieval system