KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512689
Entry
107512689         CDS       T06036                                 

Gene name
CXADR
Definition
(RefSeq) coxsackievirus and adenovirus receptor
  KO
K06788  coxsackievirus and adenovirus receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107512689 (CXADR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ray04515]
    107512689 (CXADR)
Cell adhesion molecules [BR:ray04515]
 Immunoglobulin superfamily
  CTX family
   107512689 (CXADR)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2 V-set_CD47 C2-set Syndecan Herpes_gE Shisa EphA2_TM PDGLE
Other DBs
NCBI-GeneID: 107512689
NCBI-ProteinID: XP_016003979
LinkDB
Position
Unknown
AA seq 365 aa
MALLLRVLLLCGVADFTRSLSITSADQMIEKAKGGTAYLPCKFTLSSEDQGPLDIEWLLS
PADNQKVDQVIILYSGDKIYDNYYQDLKGRVHFTSSDLKSGDASINVTNLQLSDIGTYQC
KVKKAPGVANKKIQLRVLVKPSGTRCYVDGPEEIGNDFKLKCEPKEGSLPLQYEWQKLSN
SKKLPTSLITEMTSPVISVKNATTEYSGTYSCTVTNRVGSDQCLLRLDVVPASNRAGTIA
GAVIGTLLALVLIGLIVFCCHKKRREKKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHS
SLGSMSPSNMEGYSKTQYNQVPSEDFEHAPQSPTLPPAKVAAPNLSRMGAVPVMIPAQSK
DGSIV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcgcttctgctgcgcgtcctcctcctgtgcggagtcgctgatttcaccagaagtttg
agtattactagtgctgaccagatgattgaaaaggccaaagggggaactgcctatttgcca
tgcaaattcacccttagttctgaagaccagggaccactggacatcgagtggctgctgtcg
ccagctgataatcagaaggtggaccaagtgattattttatattctggagacaaaatttat
gataactactatcaagatctgaaaggacgagtacattttacaagtagtgatctcaaatct
ggtgacgcatcaataaatgtaacaaatttacagttgtcagatattggcacatatcagtgc
aaagtgaaaaaagcccccggtgttgcaaataagaagattcagctgagagttcttgttaag
ccttcaggtacaagatgttatgttgatggaccagaagaaattggaaatgactttaaatta
aagtgtgaaccgaaagaaggttcacttccattgcaatacgaatggcaaaaattgtccaac
tcaaagaaactgcccacatcgttgataacagaaatgacttcacctgttatatctgtaaaa
aatgccactactgagtactctgggacatacagttgtacagtcaccaacagagtgggctct
gatcaatgcctcctgcgcctggatgttgttcctgcttcaaatagagctgggacaattgca
ggagctgttataggaactttgcttgctctggtgctcattggtctcatcgtcttttgctgt
cataaaaagcgcagagaaaagaagtatgaaaaggaagttcatcatgatatcagggaagac
gtgcctcctccaaagagccggacgtccaccgccagaagctacatcggcagcaatcactcg
tccctggggtccatgtctccttccaacatggaagggtattccaagactcagtataaccag
gtgccaagcgaagactttgaacatgctcctcagagtccgactctcccacctgctaaggta
gctgcccctaatctcagtaggatgggagcggtacccgtgatgattcctgcacagagcaag
gacgggtctatcgtatag

DBGET integrated database retrieval system