KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512804
Entry
107512804         CDS       T06036                                 

Gene name
SMO
Definition
(RefSeq) smoothened homolog isoform X1
  KO
K06226  smoothened
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04340  Hedgehog signaling pathway
ray04360  Axon guidance
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107512804 (SMO)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    107512804 (SMO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512804 (SMO)
   05205 Proteoglycans in cancer
    107512804 (SMO)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    107512804 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107512804 (SMO)
G protein-coupled receptors [BR:ray04030]
 Frizzled / Smoothened family
  107512804 (SMO)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 107512804
NCBI-ProteinID: XP_016004170
LinkDB
Position
Unknown
AA seq 791 aa
MAAARLTRGPELLLLGLLLLLLLLLGGPGQGAALSGNATGPGPRSAGGSARRSAVVTGPP
PLLSHCGRAAPCEPLRYNVCLGSALPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRC
WAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPEGC
PNEVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHLDMHRYIATFG
AVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRAD
GTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTS
YFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYF
LIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQA
EWERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWT
KATLLIWKRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSHDG
PVAGLAFDINEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEKANLWLVE
AEISPELEKRLGRKKKRRKRKKEVCPLVPPPELHHPAPALVSSAVPRLPQLPRQKCLVAT
GAWGAGESCRQRAWTLVTNPFCPEPSPLQDPFLPSASAPMAWAQGRRQGLGPIHSRTNLM
EAELMDADSDF
NT seq 2376 nt   +upstreamnt  +downstreamnt
atggctgcagcccgcctcacacgggggccggagctcctgctcctagggctgctgctgctg
ctgctcctgctgctggggggcccgggtcagggggcggccttgagcgggaatgcaacaggg
cctgggcctcggagcgcgggcgggagcgccagaaggagcgcggtggtgaccggccctccg
ccgctgctgagccactgcggccgggccgccccctgcgagccgctgcgctacaacgtgtgc
ctgggctcggcgctgccctacggggccacctccacgctgctggccggagactcggactcc
caggaggaagcgcacggcaagctcgtgctctggtcgggcctccggaatgcccctcgctgc
tgggcagtgatccagcccctgctgtgtgccgtgtacatgcccaagtgcgagaatgaccgg
gtggagctgcccagccgcaccctctgccaggccacccgcggcccctgtgccatcgtggag
agggagcggggctggcccgacttcctgcgctgcacccccgaccacttcccggagggctgc
ccgaatgaagtacagaacatcaagttcaacagttcaggccagtgtgaggctcccttggtt
cggaccgacaaccccaagagctggtacgaggacgtggagggctgcgggatccagtgccag
aacccgctcttcacggaggccgagcacctggacatgcacagatacatcgcgaccttcggt
gctgtcacgggcctctgcacgctcttcaccctggccacttttgtggctgactggcggaat
tcgaatcgctaccctgcggttattctcttctatgtcaatgcgtgtttctttgtgggcagc
attggctggctggcccagttcatggacggtgcccgccgggagatcgtctgccgtgcagat
ggcaccatgaggcttggggagcccacctccaacgagaccctgtcctgtgtcatcatcttt
gtcatcgtgtactatgccctgatggctggcgtcgtctggttcgtggtccttacctatgcc
tggcacacctccttcaaagccctgggcaccacctaccagcccctctctggcaaaacctcc
tatttccacctgctcacatggtcactccccttcgtcctcactgtggcaatcctcgccgtg
gcccaggtggatggggactctgtgagcggtatctgtttcgtgggctataagaactaccga
taccgtgctggcttcgtgctggccccaatcggcctggtgctcatcgtgggaggttatttc
ctcatccgaggagtcatgactctgttctccatcaagagcaaccaccctgggctgctgagc
gagaaggctgccagcaagatcaatgagaccatgctgcgcctgggcatttttggcttcctg
gcctttggctttgtgctcatcaccttcagctgccacttctatgatttcttcaaccaggct
gagtgggagcgcagcttccgggactatgtgctatgccaggccaatgtgaccatcgggctg
cccaccaagaagcccatccctgactgtgaaatcaagaatcgtcctagcctcctggtggag
aagatcaacctgtttgccatgtttggaactggcattgctatgagcacctgggtctggacc
aaggccacattactcatctggaagcgtacctggtgcaggttgacggggcagagtgatgat
gagcccaaacgcatcaagaagagcaagatgatcgccaaggccttctccaagcggcgtgag
ctgctgcagaacccaggccaggagctctccttcagtatgcacaccgtctcccacgatggg
cctgtggcgggtttggcctttgacatcaatgagccctcagcagatgtgtcctctgcctgg
gcccaacacgtcaccaaaatggtggctcggagaggagccatactgccccaggatgtatct
gtcacccctgtggcaactccagtgccccctgaggaaaaagccaacctgtggctggttgag
gcagagatctctccagagctggagaagcgcctgggccggaagaagaagcggaggaagagg
aagaaggaggtgtgccccctggtgccacctcccgagctccaccaccctgcccctgctctc
gtctccagcgctgttcctcgacttccacagctgccccggcagaagtgcctggtggccaca
ggtgcctggggagctggggaatcctgccgacagagagcctggaccctggtcaccaacccc
ttctgcccagagcccagtcccctgcaggatccgtttctgcctagtgcctccgcccccatg
gcctgggctcaaggccgccggcaggggctggggcccattcactcccgtaccaacctgatg
gaggcagagctcatggatgcggactcggacttctga

DBGET integrated database retrieval system