KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512852
Entry
107512852         CDS       T06036                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4 isoform X1
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04310  Wnt signaling pathway
ray04350  TGF-beta signaling pathway
ray04371  Apelin signaling pathway
ray04390  Hippo signaling pathway
ray04520  Adherens junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04659  Th17 cell differentiation
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05161  Hepatitis B
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05220  Chronic myeloid leukemia
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107512852 (SMAD4)
   04350 TGF-beta signaling pathway
    107512852 (SMAD4)
   04390 Hippo signaling pathway
    107512852 (SMAD4)
   04371 Apelin signaling pathway
    107512852 (SMAD4)
   04068 FoxO signaling pathway
    107512852 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107512852 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107512852 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    107512852 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107512852 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512852 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107512852 (SMAD4)
   05212 Pancreatic cancer
    107512852 (SMAD4)
   05225 Hepatocellular carcinoma
    107512852 (SMAD4)
   05226 Gastric cancer
    107512852 (SMAD4)
   05220 Chronic myeloid leukemia
    107512852 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107512852 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107512852 (SMAD4)
   05161 Hepatitis B
    107512852 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 107512852
NCBI-ProteinID: XP_016004265
LinkDB
Position
Unknown
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTESYSTPALLASSESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacaaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaaactgaaggagaaaaaggatgaattggattctttaataacagct
ataactacaaatggagctcatcctagcaaatgtgttaccatacagagaacattggatgga
aggcttcaggttgccggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgacagtgtctgtgtgaatccatatcactatgaacgagttgtatcaccggga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgacttcgagggacagccatcgttatccacggaagggcattcaattcaa
accatccaacatccaccaagtaatcgtgcttcaacagagtcatacagcaccccagctctg
ttagcttcatctgagtctaatgctaccagcaccaccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatttctaatcatcctgctcct
gagtattggtgttccatcgcttactttgaaatggatgttcaagtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatatgtggacccttctggtggagat
cgcttttgcttgggtcaactttccaacgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggggaaggtgatgtttgggtcagg
tgccttagcgaccatgcagtctttgtacagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cggcagtgtcatcggcagatgcagcagcaggcggccaccgcacaagctgcagcagctgcc
caggcagcagccgtggccggaaacatccctggcccaggatcagtaggtggaatagctcca
gctatcagtttgtccgctgctgctggaatcggtgttgatgaccttcgccgcttatgcata
ctcaggatgagtttcgtgaagggctggggaccggattacccaagacagagcatcaaagaa
acgccttgctggatcgagattcacttacaccgggctctccagctcctagatgaagttctt
cacaccatgcctattgccgacccacaacctttagactga

DBGET integrated database retrieval system