KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512864
Entry
107512864         CDS       T06036                                 

Gene name
MYLK2
Definition
(RefSeq) LOW QUALITY PROTEIN: myosin light chain kinase 2, skeletal/cardiac muscle
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04510  Focal adhesion
ray04611  Platelet activation
ray04810  Regulation of actin cytoskeleton
ray04921  Oxytocin signaling pathway
ray04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107512864 (MYLK2)
   04020 Calcium signaling pathway
    107512864 (MYLK2)
   04022 cGMP-PKG signaling pathway
    107512864 (MYLK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107512864 (MYLK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107512864 (MYLK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107512864 (MYLK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107512864 (MYLK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107512864 (MYLK2)
  09154 Digestive system
   04971 Gastric acid secretion
    107512864 (MYLK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107512864 (MYLK2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     107512864 (MYLK2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107512864 (MYLK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH
Other DBs
NCBI-GeneID: 107512864
NCBI-ProteinID: XP_016004284
LinkDB
Position
Unknown
AA seq 600 aa
MATENGAAELGIQNSSTDEAPKGAAGEDLPATEKDLDPPDPEKEPKESGPPILKKGAKAP
APEKGDSALAQSLTSSQDPEGESNLGRGPAEGSVGQPAALPQPTLTAEAAVKKPNEEQGT
SGSQDPGELKAGKEKAAEDQAVARRGSPAFLHSPSCPAVISSPEKPLAQKPPNEASELIF
EGVPMTPDPMEPGPAKAAGEKNILEGSQKEAGEQASGQADQAKVQGDISRGIEFQAVPSE
RLEVGQDLCLTAREEDCFQILDDCXPPPAPFPHRIVELRTGNVNSQFSMNSKETLGGGKF
GAVCTCTEKATGLKLAAKVIKKQTPKDKEMVMLEIEVMNQLNHRNLIQLYAAIETSHEII
LFMEYIEGGELFERIVDEDYQLTEVDTMVFVRQICDGILFMHKMSVLHLDLKPENILCVN
TTGHLVKIIDFGLARRYNPNEKLKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLL
SGLSPFLGDDDTETLNNVLSGNWYFDEETFEAVSDEAKDFVSNLIVKDQGARMSAAQCLA
HPWLNNLAEKAKRCNRRLKSQILLKKYLMKRRWKRNFIAVSAANRFKKISSSGALMALGV
NT seq 1803 nt   +upstreamnt  +downstreamnt
atggcgacagaaaacggagcagccgagctgggaatccagaactcatcaacagacgaggca
cccaaaggtgcagcaggcgaagacctcccagctacagagaaagatcttgaccccccagac
ccagagaaagaacctaaagaatctggcccacccatcctgaagaaaggtgccaaagcccct
gccccagagaaaggggatagtgccctggcccaatccttaactagcagccaggatccagag
ggagaaagcaacctgggtagggggcctgcggagggcagtgtggggcagccagcagcccta
ccccagccaaccttaacagcagaggctgctgtcaagaagcccaacgaagaacaggggacc
tcaggcagccaggaccccggagagctcaaggcaggcaaggagaaggcagcagaagaccaa
gcggtggccaggaggggctcccctgcctttctgcacagccccagctgtcctgccgtcatt
tccagccctgagaagccgctggcccagaagcccccaaatgaggcatccgagctcatcttt
gaaggggtgcccatgacccccgaccccatggaacctgggccagccaaggcagcaggagag
aagaatatcctggaaggcagccagaaggaagcaggagagcaggcttcaggccaggctgac
caggctaaggtgcaaggggacatctccagggggatcgagttccaggctgtgccctctgag
agattggaggtggggcaggacctctgtctcacagccagggaggaggactgcttccagatt
ttggacgattgcnccccacccccggcccccttcccccaccgcatcgtggagctgagaacc
ggaaacgtcaatagtcagttcagcatgaactccaaggagacgctgggcggcggcaaattt
ggagcagtctgtacctgcaccgagaaagctacaggcctcaagctggcggctaaggtcatt
aagaaacagacacccaaagacaaggaaatggtgatgctcgagatagaggttatgaaccag
ctgaaccaccgtaatctgatccagctgtatgctgccatcgagacctcgcatgagatcatc
ctgttcatggagtacatcgagggcggcgagctcttcgagaggattgtggatgaggattat
cagctgaccgaggtggacaccatggtgtttgtcaggcagatctgcgatgggatcctcttc
atgcacaagatgagcgttctgcacctggacctcaagccagagaacatcctgtgcgtcaac
accacaggccatttggtgaagatcattgacttcggcctggcacggaggtataaccccaat
gagaagctgaaggtgaattttgggaccccagagttcctgtcacctgaggtggtgaattac
gaccaaatctccgataagacagacatgtggagcatgggggtcatcacctacatgctattg
agcggcctctcccctttcttgggagatgatgacacagagaccctaaacaatgttctatct
gggaactggtactttgatgaggagaccttcgaggctgtgtcagatgaggccaaagacttt
gtctccaacctcatcgtcaaggaccagggggcccgcatgagcgctgcccagtgtctcgcc
cacccctggctcaacaacctggcagagaaagccaagcgctgtaatcgacgcctcaagtcc
cagatcttgcttaagaaatacctcatgaaaaggcgttggaagagaaacttcattgctgtc
agcgctgccaaccgcttcaagaagatcagcagctcaggggcattgatggctctgggggtc
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516607
Entry
107516607         CDS       T06036                                 

Gene name
MYLK4
Definition
(RefSeq) myosin light chain kinase family member 4 isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04510  Focal adhesion
ray04611  Platelet activation
ray04810  Regulation of actin cytoskeleton
ray04921  Oxytocin signaling pathway
ray04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107516607 (MYLK4)
   04020 Calcium signaling pathway
    107516607 (MYLK4)
   04022 cGMP-PKG signaling pathway
    107516607 (MYLK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107516607 (MYLK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107516607 (MYLK4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107516607 (MYLK4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107516607 (MYLK4)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107516607 (MYLK4)
  09154 Digestive system
   04971 Gastric acid secretion
    107516607 (MYLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107516607 (MYLK4)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     107516607 (MYLK4)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107516607 (MYLK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH
Other DBs
NCBI-GeneID: 107516607
NCBI-ProteinID: XP_016011977
LinkDB
Position
Unknown
AA seq 396 aa
MGLTTKMLKVKRLEEINPYYNSNHLEKMAFFQCADKVEKVKCFLEESSSEQESRSEKNEA
KKMWSHPNLKEMAPVKGKRTTALTDDVLAPPAPFNHRIVIAKQTAVNSFYTVSRTEILGG
GRFGQVHKCEEKATGLKLAAKIIKTRGTKDKDEVKNEITVMNQLDHVNLIQLYDAFESKN
DIILVMEYVDGGELFDRIIDDNYNLTEFDTILFIKQICEGIRHMHQMYILHLDLKPENIL
CVSRDSKQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVITY
MLLSGLSPFLGDNDAETLNNILACRWDLEEEELKDISEEAKEFISKLLIKEKSWRISASE
ALKHPWLSDHKLHSRLNAQVMKKKDCCSDGQDLVTK
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgggactcacaaccaagatgttaaaagtgaagaggctggaagaaatcaacccgtattac
aacagtaaccatctggagaaaatggccttttttcagtgcgcggacaaggtcgagaaagtg
aaatgttttctggaagaaagttctagtgaacaggagtcaagatctgaaaagaacgaggcg
aagaagatgtggtcacaccccaacctgaaggaaatggcacctgtcaaaggcaaaaggact
acagccctcacagatgatgtcctggctcctcctgccccatttaatcaccgaattgtgata
gccaaacaaacagcagtcaacagtttttatactgtgagcagaacagaaattttaggaggg
gggcgctttggccaggttcacaaatgtgaagaaaaagcaacaggtctgaagctggcggcc
aagatcattaagaccagaggcacaaaggataaggatgaggtgaagaacgagatcaccgtc
atgaaccagctggatcatgtgaacctcattcagctctacgatgcttttgagtctaagaat
gacattatcctggttatggagtatgtggatgggggtgagctgtttgacaggatcattgat
gacaactacaatctcactgagtttgatactatcctcttcatcaaacagatatgtgaggga
atacgacacatgcatcagatgtatattcttcatttggacctgaagcctgagaatatcctg
tgtgtgagtcgagattctaagcaaataaaaattattgattttggattggccagaagatac
aaacccagagagaagctgaaggtgaactttggaaccccagagtttcttgcccctgaagtt
gtgaactatgattttgtttcctttcccactgacatgtggagtgtaggggtaattacctat
atgctacttagtggtttatcccctttcctgggcgataatgatgctgagaccctgaataac
atcctggcctgcaggtgggacttagaggaggaagagttgaaggacatctcagaggaggcc
aaggaattcatctccaagcttctgattaaagagaagagttggagaataagtgcaagtgaa
gctctcaaacacccttggttgtcagaccacaagctccactccagacttaatgcacaggta
atgaagaagaaggattgctgctctgatggtcaggaccttgtgaccaaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518034
Entry
107518034         CDS       T06036                                 

Gene name
MYLK
Definition
(RefSeq) myosin light chain kinase, smooth muscle isoform X1
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04510  Focal adhesion
ray04611  Platelet activation
ray04810  Regulation of actin cytoskeleton
ray04921  Oxytocin signaling pathway
ray04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107518034 (MYLK)
   04020 Calcium signaling pathway
    107518034 (MYLK)
   04022 cGMP-PKG signaling pathway
    107518034 (MYLK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107518034 (MYLK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107518034 (MYLK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107518034 (MYLK)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107518034 (MYLK)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107518034 (MYLK)
  09154 Digestive system
   04971 Gastric acid secretion
    107518034 (MYLK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107518034 (MYLK)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     107518034 (MYLK)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107518034 (MYLK)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 23ISL Pkinase V-set PK_Tyr_Ser-Thr C2-set_2 fn3 Ig_4 Ig_6 Herpes_gE Kinase-like Kdo AvrM_N
Other DBs
NCBI-GeneID: 107518034
NCBI-ProteinID: XP_016014838
LinkDB
Position
Unknown
AA seq 2013 aa
MGDVKLASSTHVSKTSFSMDPLRAGSMPLTEAPAFILPPRNLCVKEGATAKFEGRVRGYP
EPQVMWHRNGQPITSGGRFRLDCGIRGSFSLVIHSVHEEDKGKYTCEAANGSGARQVTVE
LTVEGGFMKKHGQPVVPKTLGDRFLSPAVETRPSIWGECPPKFATKLGRAVVKEGQMGRF
SCKITGRPQPQVTWLKGDVPLQPSARVSMSEKNGMQVLEIHEVKQDDLGVYTCMVVNGSG
KASMSAELSIQGLDNANRSFVRGTKAANSDIRKEVTNGITQEPKMDSLETKAESKNCFSP
QRGSSPTWATSSQTQPRRESKLDLFEDSSHKALKTPVLQKTSSTITLQATKVQPEPRTPV
SGPFSPSGEKREKPAAPHPATLPTRQSGLGSQEVVSKVATRKIPMESRRDSTFPKFESKP
QSQEVREDQTVKFRCEVSGIPKPQVTWFLEGSPMRRREGTIEIYEDGGSHYLCLLRARAR
DSGNYSCIASNVRGQVSCDWTLFVKRLAKMEVPPSFSSVLKDCSVIEGQDFVLQCSVLGT
PAPQITWLLNEQPIQYAHSTCAAGMAELHIQDALPEDNGIYTCLAENTLGQVSCSARVTV
HEKKSDGKSEYFLPTAPGKPVAPLFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG
NEIQESEDFHFEQRGTRHSLCIQEVFPEDTGTYTCEAWNSAGAVRTKAVLTVQEPQDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALSKDTGHFEVLQNEDVFTLV
LKNVQPWHAGQYEILLKNRVGECSCQVSLMLQSSPARVPLWGREPASCEGLCGREIVADG
GGGDCYGTLRPGWPARGQGWPEEEEGEGVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTVSEEDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK
GTPKTPLPEKVPPPKPATPDFRSVLGSKKKLPTENGSNNAEALNAKAAESPKAVGNTQPS
GFLKPVGNAKPAETPKLVGNAKPAETPKPVGNAKPAETPKPMGNAKPAETPKPVGNAKPA
ETLKPVSNAKPAESVKPVGNAKPAETQKPVGNTKPAEMLKPMGNAKPAETAKPVGNAKPA
ETPKPVGNGKPEETPKPTEKELKKEVKNDVNCKRGLSGATDNEKKPESQGTAPTFKEKLR
DVHVAEGEKLLLQCQVSSDPPATITWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDR
GLYKCLAKNGAGQAECSCQVTVDDAPASENAKAPEMKSRRPKSSLPPMLGTESDATVKKK
PAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVAGTQPITCTWMKFRKQIQESEHIK
VENSESGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRS
SSLTLSWYGSSYDGGSAVQSYSVEIWDSVDKMWKELATCRSTSFNVQDLLPDREYKFRVC
AINVYGTSEPSQESELTVVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTVNTEQKVSDFYD
IEERLGSGKFGQVFRLVEKKTGKIWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQCV
DAFEDKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMKQISEGVEYIHKQGIVHLD
LKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMW
SIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMK
NRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMIS
GLSGRKSSTGSPTSPLNAEKLESEGDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSA
ARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAV
NSLGEATCTAELIVETMEEGEGEGEEEEEEEEE
NT seq 6042 nt   +upstreamnt  +downstreamnt
atgggggatgtgaagctggcttcctcgacacacgtttctaaaacctccttcagtatggat
cccttgagagctggctccatgcccctgactgaggccccggctttcattttgccccctagg
aacctctgcgtcaaagaaggagccactgccaagtttgaagggagggtccggggataccca
gagccccaagtgatgtggcacagaaatgggcaacccatcaccagtggaggccgcttccgg
ctggattgtggtatccgggggagtttcagccttgtgattcattctgtccatgaggaagac
aaaggaaagtatacctgtgaagccgccaatggtagtggtgcccgccaggtgacagtggag
ttgacagtagaagggggcttcatgaagaagcatggtcaacctgttgttcccaaaaccttg
ggggacagattcttatcccctgcagtggagacccgtcctagcatctggggagagtgcccc
ccaaagtttgctactaagctgggccgagctgttgtcaaagaaggacagatgggacgattc
tcctgcaagatcactggccggccccaaccacaggtcacctggctcaagggagatgttccc
ctgcagccaagtgcccgtgtgtccatgtctgagaagaatgggatgcaagttctggaaatc
catgaggtcaaacaagacgatttgggggtgtacacgtgcatggtggtgaacgggtcaggg
aaagcctccatgtcagctgagctttccatccaaggtttggacaatgccaataggtcattt
gtgaggggaacaaaggcagccaattcagatattagaaaggaggtgaccaatggaattaca
caggagccaaaaatggacagcctggagactaaagctgaaagtaagaactgcttcagcccc
cagagaggcagctcccccacctgggccacaagtagccagactcagccccggagggaatcc
aagctggatttgtttgaggactcatctcacaaggccctgaagacccctgtcctgcagaag
acttctagcaccatcaccctgcaggccacaaaagtccagccagaaccaagaacaccggtc
tcagggcctttctctccttctggagaaaagagggaaaagccagctgctccccatccagcc
acccttcccaccaggcagtctggcttgggaagccaagaagttgtgagcaaggttgctacc
aggaaaatccccatggagagccgaagggattcaacattccccaaatttgagagcaagcct
caaagccaggaagtccgtgaagatcaaacagtcaagttcaggtgtgaggtttcagggatc
ccaaagccccaagtgacctggttcctggaaggttcccccatgaggagacgagaaggcacc
attgagatttatgaagatggcgggtcccattacctctgcttgctgcgagcccgggcgagg
gacagcgggaactacagctgcatagcctccaatgtccgaggccaggtgtcctgtgactgg
accctctttgtgaaaagactggctaagatggaggtgcccccctcattctccagtgtccta
aaggactgtagtgtcattgaaggccaggactttgtgctgcaatgctctgtgctgggaacc
ccagcgcctcaaattacctggctgctcaatgagcagcccatccagtatgctcactctacc
tgtgcggctggcatggcagagctccacatccaggatgccctgccagaggacaatggcatc
tacacctgtctggctgagaacaccttggggcaagtgtcctgcagcgcccgggtcactgtc
cacgaaaagaagagtgacgggaagagtgaatattttctgcccacagctcctggcaagccc
gtcgcacctctcttcctgcagggcctgtctgatctcaaagtcatggatggaagccaggtc
accatgacagtccaggtgtcagggaacccgccccctgaagtcatctggcttcacaacggg
aatgagatccaggagtcagaggacttccactttgaacagagaggcactcgacacagcctt
tgtatccaggaggtgttcccagaggacacgggcacatacacctgtgaagcctggaacagc
gccggggctgtccgcaccaaggccgtgctcacggtgcaagagccacaggatggcacccag
ccctggttcatcagcaagcctcgctcagtgacggcctccctgggccagagtgtcctcatc
tcctgtgccatagctggtgaccccttccccaccgtgcactggctccgagatggcaaggcc
ctctccaaagacaccggccacttcgaggtgctacagaatgaagacgtgttcaccctggtt
ctaaaaaatgtgcagccctggcatgctggccagtatgagatcttgcttaagaaccgcgtt
ggcgaatgcagttgccaggtgtcgctgatgctacagagcagccctgcccgagttcccctg
tgggggagggagcctgccagctgtgagggcctctgcggccgagaaattgttgccgatggt
ggtggtggtgactgctatgggaccctgaggcctggctggccagcaagagggcagggttgg
ccagaggaggaggaaggtgaaggcgtgcgaggggtgctgaagaggcgtgtggagacacgg
cagcacacggaggaggccatccgccagcaggaggtggagcagctggacttccgtgacctc
ttggggaagaaggtgagcaccaagaccgtgtcggaagaagacctgaaggagatcccagct
gagcagatggatttccgcgccaacttgcaacggcaagtgaagccaaagactgtgtctgag
gaagaaagaaaggtgcacagcccccagcaggttgatttccgctctgtcttggccaaaaag
gggactcccaagaccccactgcctgagaaggtaccacctccaaaacctgccaccccagat
tttcgctcggtactgggcagcaagaaaaaattaccaacagagaatggtagcaacaatgct
gaggccttgaatgccaaggcggcagaaagtcccaaggccgtgggcaatacccagccttca
gggttcctgaaacctgtgggcaatgccaagcctgccgagaccccaaaactcgtgggtaac
gccaagccagccgagaccccgaaacccgtgggcaatgccaagcctgccgagactccaaaa
cccatgggtaacgccaagccagccgagaccccgaaacctgtgggcaatgccaaacctgcc
gagaccctaaaacctgtgagcaatgccaaaccggctgaatccgtgaaacctgttggcaat
gccaagcctgctgagacccaaaaacctgtgggcaacaccaaaccggccgagatgctgaaa
cccatgggcaatgccaagcctgccgagaccgcaaaacctgtgggcaatgccaaaccagct
gagaccccgaaacctgtgggcaatggcaagccagaagagactccaaaaccaaccgagaaa
gaactcaagaaggaggttaagaatgatgtgaactgcaagagagggctttcaggggccaca
gataatgagaaaaaaccagagagccaagggacagccccaactttcaaggagaagctacga
gatgtccatgtggcagagggtgagaagctgctacttcaatgccaggtgtcctctgatccc
ccggccaccatcacctggacactgaatggaaaaacactcaagaccaccaaattcatcatc
ctctcccaagaaggctcactctgctccgtctccattgagaaggcactgccagaggacaga
ggcttatacaagtgtttagccaagaatggcgccggccaggctgagtgctcctgccaagtc
actgtggacgatgctcctgccagtgagaatgccaaagccccagagatgaaatcccggagg
cccaagagctctcttcctcccatgctaggaacagagagtgatgcaactgtgaaaaagaaa
cctgcacccaagacacctccgaaggcagccatgccccctcagatcatccagtttcctgag
gaccaaaaggtgcgggcaggagagtccgtggagctgttcggtaaagtggcaggcacccag
cccatcacatgcacctggatgaagttccgcaagcagatccaggagagcgagcacatcaaa
gtggagaacagcgagagcggcagcaagctcaccatcctggccgcacgccaggagcactgc
ggctgctacacactgctggtggagaacaagctgggcagcagacaggctcaagtcaacctc
actgtggtcgacaagccagaccccccagccggcacaccttgtgcctctgatatccggagc
tcctcactcaccctgtcctggtacggctcttcgtatgatgggggcagcgccgtacaatcc
tacagtgtcgagatctgggactcagtggacaagatgtggaaggaactagccacatgccgc
agcacctcatttaacgtccaggacctgctgcctgaccgagagtataaattccgtgtgtgt
gcaatcaatgtgtatggaaccagtgagccaagccaggagtctgaactcacagtggtggga
gagaaacctgaagagccgaaggatgaagtggaggtgtcagatgatgatgaaaaggagccc
gaggtcgattacagaacggtgacagtcaataccgaacaaaaggtgtctgacttctacgac
atcgaagagagactaggatctgggaaatttggacaggtttttcgacttgtagaaaagaaa
actggaaaaatctgggcagggaaattcttcaaggcgtattcagcaaaagagaaagagaat
atccggcaggagatcagtatcatgaactgccttcaccaccccaagctggtccagtgcgtg
gatgccttcgaagataaggccaatatcgtcatggtcctggagattgtgtcaggaggtgag
ctgtttgagcgcatcatcgacgaggacttcgagctgacggagcgagagtgcatcaagtac
atgaagcagatctcggagggagtggagtacatccacaagcagggcatcgtccacctggac
ctcaagcctgagaacatcatgtgcgtcaacaagacaggcaccaggatcaagctcatcgac
ttcggtctggccagaaggctggagaatgccgggtctctgaaggtcctctttggcacccca
gagtttgtagcgcctgaagtgatcaactacgagcccattggctatgccacggacatgtgg
agcatcggagtcatctgctacatcctggtcagtggactgtccccattcatgggtgacaac
gacaatgaaaccttagccaacgttacctcagccacctgggactttgacgacgaggcattt
gatgagatctccgatgatgcaaaggattttatcagcaacttgctcaagaaagatatgaaa
aaccgcctggactgtacccagtgccttcagcatccatggctaatgaaagacaccaagaac
atggaggccaagaagctctccaaggaccggatgaagaagtacatggcaagaaggaaatgg
cagaaaacgggcaatgctgtgagagccatcggaagactgtcctctatggcaatgatctca
gggctcagtggcaggaaatcctcgacaggatcaccaaccagcccactcaacgcagaaaaa
ctagaatctgaaggagatgtctcccaagctttcctggaggctgttgccgaggaaaagccc
catgtaaaaccctatttctctaagaccattcgtgatttagaagtcgtggagggaagtgct
gctagatttgactgcaagattgaaggatacccagaccctgaggttgtctggttcaaagat
gaccaatcgatcagggagtctcgccacttccagatagactacgatgaggatgggaactgc
tctttaatcattagcgatgtttgcggggatgacgatgccaagtacacctgcaaggctgtc
aacagtcttggagaagccacctgcacagccgagctcattgtggaaaccatggaggaagga
gaaggggaaggggaagaggaagaagaggaagaggaagagtga

DBGET integrated database retrieval system