KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512887
Entry
107512887         CDS       T06036                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01524  Platinum drug resistance
ray04014  Ras signaling pathway
ray04064  NF-kappa B signaling pathway
ray04115  p53 signaling pathway
ray04137  Mitophagy - animal
ray04140  Autophagy - animal
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04215  Apoptosis - multiple species
ray04621  NOD-like receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05022  Pathways of neurodegeneration - multiple diseases
ray05145  Toxoplasmosis
ray05162  Measles
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05212  Pancreatic cancer
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107512887 (BCL2L1)
   04630 JAK-STAT signaling pathway
    107512887 (BCL2L1)
   04064 NF-kappa B signaling pathway
    107512887 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    107512887 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107512887 (BCL2L1)
   04137 Mitophagy - animal
    107512887 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    107512887 (BCL2L1)
   04215 Apoptosis - multiple species
    107512887 (BCL2L1)
   04115 p53 signaling pathway
    107512887 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107512887 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512887 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    107512887 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107512887 (BCL2L1)
   05225 Hepatocellular carcinoma
    107512887 (BCL2L1)
   05220 Chronic myeloid leukemia
    107512887 (BCL2L1)
   05222 Small cell lung cancer
    107512887 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107512887 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    107512887 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    107512887 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107512887 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    107512887 (BCL2L1)
   05162 Measles
    107512887 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    107512887 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107512887 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107512887 (BCL2L1)
   01524 Platinum drug resistance
    107512887 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107512887 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107512887 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107512887 (BCL2L1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107512887 (BCL2L1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107512887 (BCL2L1)
Transporters [BR:ray02000]
 Other transporters
  Pores ion channels [TC:1]
   107512887 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 107512887
NCBI-ProteinID: XP_016004329
LinkDB
Position
Unknown
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMEPPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWLLTGVTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagttcagtgatgtggaagagaacagaactgaggccccagaagga
actgaatcagagatggagccccccagtgccatcaatggcaacccatcctggcacctggcg
gacagccctgcagtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcagtgaaacaagcactgagagaggcaggtgatgagtttgaactgagg
taccggcgggcattcagcgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gttttggtgagtcggattgcaacttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacgttcgtggaactctacgggaacaatgcagcg
gccgagagccggaagggtcaggagcgcttcaaccgctggcttctgacaggagtgactgtg
gctggcgtggttctgctgggctcacttttcagtcggaaatga

DBGET integrated database retrieval system