KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512952
Entry
107512952         CDS       T06036                                 

Gene name
DRD2
Definition
(RefSeq) D(2) dopamine receptor
  KO
K04145  dopamine receptor D2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04540  Gap junction
ray04728  Dopaminergic synapse
ray05012  Parkinson disease
ray05030  Cocaine addiction
ray05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107512952 (DRD2)
   04024 cAMP signaling pathway
    107512952 (DRD2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107512952 (DRD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107512952 (DRD2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    107512952 (DRD2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107512952 (DRD2)
  09165 Substance dependence
   05030 Cocaine addiction
    107512952 (DRD2)
   05034 Alcoholism
    107512952 (DRD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107512952 (DRD2)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    107512952 (DRD2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv RIFIN Stevor
Other DBs
NCBI-GeneID: 107512952
NCBI-ProteinID: XP_016004476
LinkDB
Position
Unknown
AA seq 456 aa
MARAWPPCGPTAPMDPLNLSWYDDDLEGQNWSRPFNGSEGKAGRPHYNYYAMLLTLLIFI
IVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHC
DIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTIS
CPLLFGLNHTEQSECIIANPAFVVYSSVVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKR
SSRAFRANLRAPLKGSCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSST
SPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQSMP
NGKTRTSLKTLSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVL
YSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggccagagcctggccaccctgtggccccactgccccgatggatccactgaacctgtcc
tggtatgatgatgatctggagggccagaactggagccggcccttcaatgggtccgaagga
aaggccggcaggccacactacaactactacgccatgctgctcacgctgctcatcttcatc
atcgtctttggcaacgtgctggtgtgcatggccgtgtcccgtgagaaggctctgcagacc
accaccaactacctgatcgtcagcctcgccgtggctgacctcctcgttgccacgctcgtc
atgccgtgggttgtctacctggaggtggtgggtgagtggaaattcagcaggattcactgt
gacatctttgtcactctggacgtcatgatgtgcacagcaagcatcctgaacctgtgtgcc
atcagcatcgacaggtacacagctgtggccatgcccatgctctacaacacacgctacagc
tccaaacgccgagtcactgttatgatcgccatcgtctgggtcttatccttcaccatctcc
tgccccctgctctttggactcaaccacacagagcagagcgagtgcatcatcgccaaccct
gccttcgtggtctactcctccgtagtctccttctacgtgcccttcatcgtcacgctgctg
gtctacatcaagatctacatcgtcctgcggaggcgccggaagcgggtcaacaccaagcgc
agcagccgggctttcagggccaacctgagggccccactcaagggcagctgcactcacccc
gaggacatgaaactctgcaccgttatcatgaagtctaatggcagtttcccagtgaacagg
cgaagagtggaggctgcccgccgagcccaggagctagagatggagatgctctccagcacc
agcccacctgagaggacccggtacagccccatcccacctagccaccaccagctgaccctc
cccgacccatcccaccacggcctccacagcactcccgacagccccgccaaacccgagaag
aatgggcatgccaaagaccaccccaagattgccaagatctttgagatccagtccatgccc
aatggcaaaacccggacctcgctcaagaccctgagccgcagaaagctctctcagcagaag
gagaagaaagccacccagatgctcgccatcgtcctcggcgtgttcatcatctgctggctg
cccttcttcatcacacacatcctgaacattcactgtgattgcaacatcccacctgtcctg
tacagcgccttcacgtggctgggctatgtcaacagcgccgtgaaccccatcatctacaca
accttcaacatcgagttccgcaaggccttcatgaagatcctccactgctga

DBGET integrated database retrieval system