KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513012
Entry
107513012         CDS       T06036                                 

Gene name
VIP
Definition
(RefSeq) VIP peptides
  KO
K05264  vasoactive intestinal peptide
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107513012 (VIP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107513012 (VIP)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 107513012
NCBI-ProteinID: XP_016004611
LinkDB
Position
Unknown
AA seq 158 aa
METRRKPQLLLSLIVLSALFSQMSAWPLFEAPSLRIPFEGANELDRGSLKADTDILQNAF
AENDRNARHADGIFTSDFSRLLGQLSAKKYLESLIGKRVGNNISEDQGPIKRHSDAVFTD
NYTRLRKQMAVKKYLNSILNGKRSTDGESPDFLEELEK
NT seq 477 nt   +upstreamnt  +downstreamnt
atggaaaccagaagaaagccccagctcctcttgagcctgatagttctcagcgcgctcttc
tcacagatgtcggcctggcctctttttgaagcaccttctctgagaataccatttgaagga
gccaatgaacttgatcgaggttcattaaaagcagacactgacatcttgcaaaatgcattt
gctgaaaatgacaggaatgccagacatgctgatgggatttttaccagtgactttagtaga
cttttgggtcaactgtctgccaaaaaataccttgagtcccttattggaaaacgagttggc
aataacatctccgaagaccagggacccatcaaacgccactcggatgcagtcttcactgac
aactacacccgcctgcgaaaacaaatggctgtaaagaaatacttgaactcaattctaaat
ggaaagagaagcactgacggagaatctcctgattttcttgaagagttagaaaaatga

DBGET integrated database retrieval system