KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513058
Entry
107513058         CDS       T06036                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04520  Adherens junction
ray04530  Tight junction
ray04660  T cell receptor signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04722  Neurotrophin signaling pathway
ray04810  Regulation of actin cytoskeleton
ray04912  GnRH signaling pathway
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05100  Bacterial invasion of epithelial cells
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107513058 (CDC42)
   04014 Ras signaling pathway
    107513058 (CDC42)
   04015 Rap1 signaling pathway
    107513058 (CDC42)
   04370 VEGF signaling pathway
    107513058 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107513058 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107513058 (CDC42)
   04520 Adherens junction
    107513058 (CDC42)
   04530 Tight junction
    107513058 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107513058 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107513058 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    107513058 (CDC42)
   04670 Leukocyte transendothelial migration
    107513058 (CDC42)
   04062 Chemokine signaling pathway
    107513058 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107513058 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107513058 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    107513058 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513058 (CDC42)
   05205 Proteoglycans in cancer
    107513058 (CDC42)
   05203 Viral carcinogenesis
    107513058 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107513058 (CDC42)
   05211 Renal cell carcinoma
    107513058 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107513058 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107513058 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107513058 (CDC42)
   05135 Yersinia infection
    107513058 (CDC42)
   05100 Bacterial invasion of epithelial cells
    107513058 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107513058 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107513058 (CDC42)
   03036 Chromosome and associated proteins [BR:ray03036]
    107513058 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107513058 (CDC42)
   04031 GTP-binding proteins [BR:ray04031]
    107513058 (CDC42)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    107513058 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    107513058 (CDC42)
  Macropinocytosis
   Ras GTPases
    107513058 (CDC42)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107513058 (CDC42)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   107513058 (CDC42)
  Exosomal proteins of breast milk
   107513058 (CDC42)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107513058 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 107513058
NCBI-ProteinID: XP_016004766
LinkDB
Position
Unknown
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgcgttgttgtgggcgatggtgccgttggtaaaacatgtctcctg
atatcctatacaacaaacaaatttccatctgagtatgtaccaactgtttttgacaactat
gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttacccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
acggctgaaaagctagcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactc
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system