KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513058
Entry
107513058         CDS       T06036                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04520  Adherens junction
ray04530  Tight junction
ray04660  T cell receptor signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04722  Neurotrophin signaling pathway
ray04810  Regulation of actin cytoskeleton
ray04912  GnRH signaling pathway
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05100  Bacterial invasion of epithelial cells
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107513058 (CDC42)
   04014 Ras signaling pathway
    107513058 (CDC42)
   04015 Rap1 signaling pathway
    107513058 (CDC42)
   04370 VEGF signaling pathway
    107513058 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107513058 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107513058 (CDC42)
   04520 Adherens junction
    107513058 (CDC42)
   04530 Tight junction
    107513058 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107513058 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107513058 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    107513058 (CDC42)
   04670 Leukocyte transendothelial migration
    107513058 (CDC42)
   04062 Chemokine signaling pathway
    107513058 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107513058 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107513058 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    107513058 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513058 (CDC42)
   05205 Proteoglycans in cancer
    107513058 (CDC42)
   05203 Viral carcinogenesis
    107513058 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107513058 (CDC42)
   05211 Renal cell carcinoma
    107513058 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107513058 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107513058 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107513058 (CDC42)
   05135 Yersinia infection
    107513058 (CDC42)
   05100 Bacterial invasion of epithelial cells
    107513058 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107513058 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107513058 (CDC42)
   03036 Chromosome and associated proteins [BR:ray03036]
    107513058 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107513058 (CDC42)
   04031 GTP-binding proteins [BR:ray04031]
    107513058 (CDC42)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    107513058 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    107513058 (CDC42)
  Macropinocytosis
   Ras GTPases
    107513058 (CDC42)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107513058 (CDC42)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   107513058 (CDC42)
  Exosomal proteins of breast milk
   107513058 (CDC42)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107513058 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 107513058
NCBI-ProteinID: XP_016004766
LinkDB
Position
Unknown
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgcgttgttgtgggcgatggtgccgttggtaaaacatgtctcctg
atatcctatacaacaaacaaatttccatctgagtatgtaccaactgtttttgacaactat
gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttacccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
acggctgaaaagctagcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactc
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515925
Entry
107515925         CDS       T06036                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform X1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04071  Sphingolipid signaling pathway
ray04145  Phagosome
ray04151  PI3K-Akt signaling pathway
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04520  Adherens junction
ray04530  Tight junction
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04722  Neurotrophin signaling pathway
ray04810  Regulation of actin cytoskeleton
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04972  Pancreatic secretion
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05100  Bacterial invasion of epithelial cells
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05163  Human cytomegalovirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05231  Choline metabolism in cancer
ray05416  Viral myocarditis
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107515925 (RAC1)
   04014 Ras signaling pathway
    107515925 (RAC1)
   04015 Rap1 signaling pathway
    107515925 (RAC1)
   04310 Wnt signaling pathway
    107515925 (RAC1)
   04370 VEGF signaling pathway
    107515925 (RAC1)
   04071 Sphingolipid signaling pathway
    107515925 (RAC1)
   04024 cAMP signaling pathway
    107515925 (RAC1)
   04151 PI3K-Akt signaling pathway
    107515925 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107515925 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107515925 (RAC1)
   04520 Adherens junction
    107515925 (RAC1)
   04530 Tight junction
    107515925 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107515925 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107515925 (RAC1)
   04620 Toll-like receptor signaling pathway
    107515925 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    107515925 (RAC1)
   04662 B cell receptor signaling pathway
    107515925 (RAC1)
   04664 Fc epsilon RI signaling pathway
    107515925 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    107515925 (RAC1)
   04670 Leukocyte transendothelial migration
    107515925 (RAC1)
   04062 Chemokine signaling pathway
    107515925 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    107515925 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107515925 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    107515925 (RAC1)
   04380 Osteoclast differentiation
    107515925 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107515925 (RAC1)
   05205 Proteoglycans in cancer
    107515925 (RAC1)
   05203 Viral carcinogenesis
    107515925 (RAC1)
   05231 Choline metabolism in cancer
    107515925 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107515925 (RAC1)
   05212 Pancreatic cancer
    107515925 (RAC1)
   05211 Renal cell carcinoma
    107515925 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107515925 (RAC1)
   05020 Prion disease
    107515925 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    107515925 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107515925 (RAC1)
   05416 Viral myocarditis
    107515925 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107515925 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107515925 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107515925 (RAC1)
   05135 Yersinia infection
    107515925 (RAC1)
   05100 Bacterial invasion of epithelial cells
    107515925 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107515925 (RAC1)
   05163 Human cytomegalovirus infection
    107515925 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107515925 (RAC1)
   05169 Epstein-Barr virus infection
    107515925 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107515925 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107515925 (RAC1)
   04031 GTP-binding proteins [BR:ray04031]
    107515925 (RAC1)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    107515925 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    107515925 (RAC1)
  Macropinocytosis
   Ras GTPases
    107515925 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    107515925 (RAC1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107515925 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   107515925 (RAC1)
  Exosomal proteins of colorectal cancer cells
   107515925 (RAC1)
  Exosomal proteins of bladder cancer cells
   107515925 (RAC1)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107515925 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 107515925
NCBI-ProteinID: XP_016010671
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacgaccaatgcctttcccggagaatatatccccaccgtctttgacaactat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggacacggccgga
caagaagattacgacagattacgtcccctctcctatccacagacagacgtattcttaatt
tgcttttctctcgtgagccctgcatcgtttgaaaatgttcgcgcaaagtggtatcctgaa
gtgcgacaccattgtcccaacactcccatcatcctggtggggactaagcttgatcttagg
gatgataaagacacgattgagaaactgaaagagaagaagctgacgcccatcacctacccg
cagggcttagccatggctaaggagatcggtgctgtgaaatacctggagtgctccgctctc
acgcagcgaggcctcaagacagtgttcgacgaagccattcgcgccgttctctgcccgcct
cctgtcaagaaaaggaagagaaagtgcctgctgttgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519267
Entry
107519267         CDS       T06036                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04071  Sphingolipid signaling pathway
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04520  Adherens junction
ray04613  Neutrophil extracellular trap formation
ray04650  Natural killer cell mediated cytotoxicity
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray05020  Prion disease
ray05135  Yersinia infection
ray05163  Human cytomegalovirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05231  Choline metabolism in cancer
ray05416  Viral myocarditis
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107519267 (RAC2)
   04014 Ras signaling pathway
    107519267 (RAC2)
   04015 Rap1 signaling pathway
    107519267 (RAC2)
   04310 Wnt signaling pathway
    107519267 (RAC2)
   04370 VEGF signaling pathway
    107519267 (RAC2)
   04071 Sphingolipid signaling pathway
    107519267 (RAC2)
   04024 cAMP signaling pathway
    107519267 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107519267 (RAC2)
   04520 Adherens junction
    107519267 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107519267 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107519267 (RAC2)
   04650 Natural killer cell mediated cytotoxicity
    107519267 (RAC2)
   04662 B cell receptor signaling pathway
    107519267 (RAC2)
   04664 Fc epsilon RI signaling pathway
    107519267 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    107519267 (RAC2)
   04670 Leukocyte transendothelial migration
    107519267 (RAC2)
   04062 Chemokine signaling pathway
    107519267 (RAC2)
  09158 Development and regeneration
   04360 Axon guidance
    107519267 (RAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519267 (RAC2)
   05231 Choline metabolism in cancer
    107519267 (RAC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107519267 (RAC2)
   05212 Pancreatic cancer
    107519267 (RAC2)
  09164 Neurodegenerative disease
   05020 Prion disease
    107519267 (RAC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107519267 (RAC2)
   05416 Viral myocarditis
    107519267 (RAC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107519267 (RAC2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107519267 (RAC2)
   05163 Human cytomegalovirus infection
    107519267 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ray04031]
    107519267 (RAC2)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107519267 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 107519267
NCBI-ProteinID: XP_016017258
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRPCSIL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggagctgtgggcaagacctgccttctc
atcagctacaccaccaacgccttcccaggagagtacatccccaccgtgttcgacaactat
tcagccaacgtgatggtggacagcaagcccgtgaacctgggcctgtgggatactgcaggc
caggaggactacgaccgcctccggccactctcctacccgcagacggatgtcttcctcatc
tgcttctccctcgtcagcccagcttcctacgagaatgtccgtgccaagtggttccctgag
gtgcggcaccactgccccagcacaccgatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaagctgaaggagaagaagctggcacctatcacctacccg
cagggcctggcactggccaaggagattgactccgtgaaatacctggagtgctctgccctc
acccagcgaggcctcaaaaccgtctttgatgaggcgatccgggccgtcctgtgcccccag
cccacgcggccgcagaagcgcccctgcagcatcctctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520254
Entry
107520254         CDS       T06036                                 

Gene name
RAC3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04071  Sphingolipid signaling pathway
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04520  Adherens junction
ray04650  Natural killer cell mediated cytotoxicity
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05135  Yersinia infection
ray05163  Human cytomegalovirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05231  Choline metabolism in cancer
ray05416  Viral myocarditis
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107520254 (RAC3)
   04014 Ras signaling pathway
    107520254 (RAC3)
   04015 Rap1 signaling pathway
    107520254 (RAC3)
   04310 Wnt signaling pathway
    107520254 (RAC3)
   04370 VEGF signaling pathway
    107520254 (RAC3)
   04071 Sphingolipid signaling pathway
    107520254 (RAC3)
   04024 cAMP signaling pathway
    107520254 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107520254 (RAC3)
   04520 Adherens junction
    107520254 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107520254 (RAC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107520254 (RAC3)
   04662 B cell receptor signaling pathway
    107520254 (RAC3)
   04664 Fc epsilon RI signaling pathway
    107520254 (RAC3)
   04062 Chemokine signaling pathway
    107520254 (RAC3)
  09158 Development and regeneration
   04360 Axon guidance
    107520254 (RAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107520254 (RAC3)
   05231 Choline metabolism in cancer
    107520254 (RAC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107520254 (RAC3)
   05212 Pancreatic cancer
    107520254 (RAC3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107520254 (RAC3)
   05416 Viral myocarditis
    107520254 (RAC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107520254 (RAC3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107520254 (RAC3)
   05163 Human cytomegalovirus infection
    107520254 (RAC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ray04031]
    107520254 (RAC3)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    107520254 (RAC3)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 107520254
NCBI-ProteinID: XP_016019298
LinkDB
Position
Unknown
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgcgtggtggtcggcgacggcgccgtggggaagacctgcctgctg
atcagctacacgaccaacgccttccccggagagtacatccccaccgtttttgacaactac
tcggcgaacgtgatggtggacggcaagccggtcaacctggggctgtgggacacggcgggg
caggaggactacgaccggctgcggcccctctcctacccccaaaccgacgtcttcctcatc
tgcttctccctggtgagccccgcctcctttgagaacgttcgagccaagtggtacccggag
gtgcggcaccactgcccccacacgcccatcctcctggtgggcaccaagctggacctccgt
gacgacaaggacaccattgagcggctgcgggacaagaagctggcgcccatcacatacccg
cagggcctggccatggcccgggagatcggctctgtcaagtacctggagtgctcggccctg
acccagcggggcctgaagacagtgttcgatgaggccatcagggccgtgctctgcccgccg
cccgtgaagaagccggggaagaagtgcacggtcctctag

DBGET integrated database retrieval system