KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513070
Entry
107513070         CDS       T06036                                 

Gene name
EDNRB
Definition
(RefSeq) endothelin B receptor isoform X1
  KO
K04198  endothelin receptor type B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04916  Melanogenesis
ray04926  Relaxin signaling pathway
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107513070 (EDNRB)
   04022 cGMP-PKG signaling pathway
    107513070 (EDNRB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107513070 (EDNRB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107513070 (EDNRB)
   04916 Melanogenesis
    107513070 (EDNRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513070 (EDNRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107513070 (EDNRB)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Peptide
   Endothelin
    107513070 (EDNRB)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 107513070
NCBI-ProteinID: XP_016004801
LinkDB
Position
Unknown
AA seq 444 aa
MHQLPSMCGRALVALLILACGVAEVQGEERGFPSAGATPLLLGTGEIKASPTKTSWPRES
NVSLQLSSVPPQIPETEKPARAPPRTLAPPPCEGTIEIKETFKYINTVVSCLVFVLGIIG
NSTLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPISVYKLLAEDWPFGVEMCKLVP
FIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAIPEAV
GFDMITTDYKGSYLRICLLHPIQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTC
EMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYDQNDPNRC
ELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKP
SCLKFKANDHGYDNFRSSNKYSSS
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgcaccagctgccaagcatgtgcggacgggccctggtggcgctgctgatccttgcctgc
ggcgtggcggaggtccagggagaagagaggggattcccgtcagctggggccactccgctg
cttctggggaccggagagatcaaggcgtcccccactaagacctcatggccgagggagtcc
aacgtcagcttgcagctgtcatcagtacctccgcagattcctgagacggagaagccggca
agagcccctccacggaccctcgccccgcccccgtgtgaaggaaccattgagatcaaagaa
actttcaaatacatcaacacagtggtgtcctgcctagtgttcgtgctgggcatcatcggg
aactccacgctgctgagaatcatttacaagaacaagtgcatgagaaatggccccaatatc
ttgatagccagcctggctctgggagacctgctgcacatcatcattgacatccccatcagt
gtctacaagcttctcgcagaggactggccctttggagttgagatgtgtaagctggtgcct
ttcatacagaaggcctccgtgggaatcacggtgctgagcctgtgtgctctaagtattgac
agatatcgagctgttgcatcttggagtcgaattaaaggaattggggttccaaaatggaca
gcagtagaaattgttttaatttgggtggtctctgtagttctggccatccctgaagccgtg
ggttttgacatgattaccactgactacaaaggaagttatctgcgcatctgcttacttcat
cccattcagaaaacagccttcatgcagttttacaagacagcgaaagactggtggctattt
agtttctatttctgtttgccattggccatcactgcatttttttataccctgatgacttgt
gaaatgttgagaaagaagagtggcatgcaaattgctttaaatgaccacttaaagcagaga
cgggaagtggccaaaacagtattttgcctggtccttgtctttgccctgtgttggcttccc
cttcacctcagcagaattttgaagctcactctttatgatcagaatgatcccaatagatgt
gaacttttgagctttttgttggtattggattacattggcatcaacatggcctccctgaat
tcctgcattaatccaatagctctctatttggtgagcaaaagattcaaaaactgcttcaag
tcatgcttatgctgctggtgccagtcatttgaagaaaagcagtccttggaggaaaagccg
tcgtgcttaaagttcaaagctaatgatcacggatatgacaacttccgttccagtaataaa
tacagctcatcttga

DBGET integrated database retrieval system