KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513109
Entry
107513109         CDS       T06036                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR isoform X1
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04066  HIF-1 signaling pathway
ray04072  Phospholipase D signaling pathway
ray04136  Autophagy - other
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04218  Cellular senescence
ray04371  Apelin signaling pathway
ray04613  Neutrophil extracellular trap formation
ray04630  JAK-STAT signaling pathway
ray04659  Th17 cell differentiation
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04920  Adipocytokine signaling pathway
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04935  Growth hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05221  Acute myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107513109 (MTOR)
   04371 Apelin signaling pathway
    107513109 (MTOR)
   04630 JAK-STAT signaling pathway
    107513109 (MTOR)
   04066 HIF-1 signaling pathway
    107513109 (MTOR)
   04072 Phospholipase D signaling pathway
    107513109 (MTOR)
   04151 PI3K-Akt signaling pathway
    107513109 (MTOR)
   04152 AMPK signaling pathway
    107513109 (MTOR)
   04150 mTOR signaling pathway
    107513109 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107513109 (MTOR)
   04136 Autophagy - other
    107513109 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    107513109 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107513109 (MTOR)
   04659 Th17 cell differentiation
    107513109 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107513109 (MTOR)
   04920 Adipocytokine signaling pathway
    107513109 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    107513109 (MTOR)
   04919 Thyroid hormone signaling pathway
    107513109 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    107513109 (MTOR)
   04213 Longevity regulating pathway - multiple species
    107513109 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    107513109 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513109 (MTOR)
   05206 MicroRNAs in cancer
    107513109 (MTOR)
   05205 Proteoglycans in cancer
    107513109 (MTOR)
   05230 Central carbon metabolism in cancer
    107513109 (MTOR)
   05231 Choline metabolism in cancer
    107513109 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107513109 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107513109 (MTOR)
   05212 Pancreatic cancer
    107513109 (MTOR)
   05225 Hepatocellular carcinoma
    107513109 (MTOR)
   05226 Gastric cancer
    107513109 (MTOR)
   05214 Glioma
    107513109 (MTOR)
   05221 Acute myeloid leukemia
    107513109 (MTOR)
   05215 Prostate cancer
    107513109 (MTOR)
   05224 Breast cancer
    107513109 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107513109 (MTOR)
   05014 Amyotrophic lateral sclerosis
    107513109 (MTOR)
   05016 Huntington disease
    107513109 (MTOR)
   05017 Spinocerebellar ataxia
    107513109 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    107513109 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107513109 (MTOR)
   04931 Insulin resistance
    107513109 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107513109 (MTOR)
   05168 Herpes simplex virus 1 infection
    107513109 (MTOR)
   05163 Human cytomegalovirus infection
    107513109 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107513109 (MTOR)
   05165 Human papillomavirus infection
    107513109 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107513109 (MTOR)
   01522 Endocrine resistance
    107513109 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107513109 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107513109 (MTOR)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107513109 (MTOR)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   107513109 (MTOR)
Membrane trafficking [BR:ray04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    107513109 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME EPSP_synthase HEAT_EZ
Other DBs
NCBI-GeneID: 107513109
NCBI-ProteinID: XP_016004876
LinkDB
Position
Unknown
AA seq 2134 aa
MNHVLSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAM
QVDATVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQ
DGLLKMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEG
HSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVL
SKLLVVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVG
RLSSMNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPIL
KALILKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAK
RQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDP
YKHKVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALM
RIFRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQL
GMLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIP
HMLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAAL
ETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVN
KVLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIHQHRTQRSGQGDASASGPVETGPMK
KLHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARD
LFNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRD
DNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYA
MKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQ
CCEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDL
FSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIR
QIWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLL
LGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSSRKIDAFQHMQHFVQTMQQQAQHAIATED
QQHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVM
NFEAVLHYKHQNQARDEKKKLRHASGANITNAATAATTAATATATATSTEGSNSESDAES
SENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGH
WPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYP
LTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEAS
RLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVK
DLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQS
IAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTS
LRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDY
DHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILG
LGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGN
YRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSV
EILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSH
DETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 6405 nt   +upstreamnt  +downstreamnt
atgaaccatgtcctgagctgtgtcaagaaggagaaggaacgtacagcagcctttcaagct
ctggggctactttctgtggctgtgaggtctgaatttaaggtctatttaccacgtgtgctg
gacatcatccgagcagccctgccccctaaggactttgctcataagagacagaaggcaatg
caggtggatgccaccgtgttcacctgcatcagcatgctggcgcgggcgatggggccaggt
atccagcaggacatcaaggagctgctagagcctatgctggccgtgggactgagccccgcc
ctcacagctgtgctctacgacctgagccgtcagattccgcagctgaagaaggacatccag
gacgggctcctgaagatgctgtcccttgtccttatgcacaaaccccttcggcacccaggc
atgcccaagggcctggcccaccagctggcttcccctggcctcacaactcttcccgaagcc
agtgatgtgggcagcatcacccttgccctccggactcttggcagctttgaatttgaagga
cactctctgacccagttcgtccgtcactgtgcggatcacttcctgaacagtgagcataag
gagatccgcatggaagccgcccgcacctgctcccgcctgctcacgccctccgttcacctc
atcagtggccacgcacacgtggttagccagactgcagtgcaagtggtggcagatgtgctc
agcaaactgctcgtggttgggataacagatcccgaccctgacatccgctactgtgtcttg
gcatccttggatgagcgcttcgatgcacatctggcccaggcagagaatttgcaggccctg
ttcgtagccctgaacgaccaggtgtttgagatccgggagctggccatctgcactgtgggc
cggctcagtagcatgaacccagccttcgtcatgcctttcctacgcaagatgctcatccag
attttgacagagctggagcacagtggtattggaagaatcaaagagcagagtgcccgcatg
ctggggcacctggtctccaatgccccccgactcatccgcccttacatggagcccattctg
aaggctttaattttgaaattgaaagatccagaccctgatccaaacccaggtgtgatcaat
aatgtcttggctacaataggagagttagctcaggttagtggcctggaaatgaggaagtgg
gttgatgagctttttatcatcatcatggacatgctccaggactcctctctgttggccaaa
aggcaggtggctctgtggaccctgggacagttggtagccagcactggctatgtggtggag
ccctacaggaagtaccccactttgctagaggtactgctgaatttcctgaagactgagcag
aaccagggtacacggagagaggctatccgtgtgttagggcttttgggagccttggatccc
tataagcacaaagtgaacatcggcatgattgaccagtcccgggacgcttctgctgtcagc
ctgtcagagtccaagtcaagccaggattcctctgactacagcaccagcgaaatgctggtc
aacatggggaacctgcctctggatgagttttacccagccgtgtccatggtggccctgatg
cgcatcttccgagaccagtccctctctcaccaccacaccatggttgtccaggccatcacc
ttcatcttcaagtcactgggcctcaagtgtgtgcagttcctgccccaggtcatgcccaca
ttcctgaacgtcatccgtgtctgtgacggggccatccgggaatttctgttccagcagctg
ggaatgttggtgtcttttgtgaagagccacatcagaccttacatggatgaaatagtcacc
ctcatgagagagttctgggtcatgaacacctcgatccagagcacgatcattcttctcatt
gagcaaattgtggtcgctcttggaggtgaatttaagctctacctgccccagctgatcccg
catatgctgcgagtcttcatgcacgacaacagcccgggccgcatcgtctccatcaagttg
ctggctgcaatccagctgttcggggccaacctggatgactatctgcatttgttgctgccc
cccatcgtgaagttgtttgatgcccctgaggtcccactgccatctcgaaaggcagcgttg
gagacggtggaccgcctgaccgagtccctggacttcactgactacgcctcccggatcatt
cacccgatcgtgcgaacactggaccagagcccggaactgcgtcccacagccatggacacg
ttgtcttcactcgtctttcagctggggaagaagtaccaaattttcattccgatggtgaat
aaagttctggtgcgacaccgaatcaaccatcagcgctacgatgtcctcatctgcagaatt
gtcaagggctacacccttgccgacgaggaggaggaccctttgattcaccagcatcgaacg
cagaggagtggccaaggggacgcgtcagctagtgggccagtggagacgggacccatgaag
aagctgcacgtcagcaccatcaacctccaaaaggcctggggagctgccagaagggtctcc
aaagatgactggctggagtggctgaggcggctgagcctggagctgctgaaggactcctcg
tcgccctccctgcgctcatgctgggccctggcccaggcctacaacccgatggccagggat
ctctttaacgctgcgtttgtgtcctgctggtctgaactgaacgaagaccaacaggatgaa
ctcatcagaagcatcgagttggccctcacctcgcaagatatcgccgaagtcacacaaacc
ctcttaaacctggctgaattcatggaacacagtgacaagggccccctgccactgagagac
gacaatggcattgttctgctgggtgagagggccgccaagtgccgggcgtatgccaaagcg
ctgcactacaaagagctggagttccagaagggtcccaccccggccatcctagagtctctc
atcagtattaataataagctacagcaaccggaggcagcagccggggtgttagaatatgcc
atgaaacacttcggagagctggagatccaggcgacctggtatgagaagctgcacgagtgg
gaggacgcccttgtcgcctatgataagaaaatggacaccaacaaggatgacccagagctg
atgctgggccgcatgcgctgcctcgaggccctgggggaatgggggcagctccaccagcag
tgctgtgagaagtggaccctggtgaacgacgagacccaagccaagatggcccggatggcc
gctgccgccgcgtggggtttaggtcagtgggacagcatggaagagtacacctgtatgatc
cctcgggacacccacgacggggcgttttatagagccgtgctggcactacatcaggacctc
ttctccctggcacaacagtgcatcgacaaagccagggacctgctggacgccgagttgact
gctatggcgggagagagctacagtcgggcgtatggggccatggtttcctgccacatgctc
tcggagctggaggaggttatccagtacaaactcgtccccgagcggcgagagatcatccgc
cagatctggtgggagaggctgcagggctgccagcgtatcgtggaggactggcagaagatc
cttatggtgcggtcccttgtggtcagccctcatgaggacatgaggacctggctcaagtat
gcaagcctgtgtggcaagagcggcaggctggctcttgctcataaaaccttagtgttactc
ctgggagtcgatccatcccggcaacttgaccatcctctgcccacagttcacccgcaggtg
acctacgcctacatgaaaaacatgtggaagagttctcgcaagatcgatgccttccagcac
atgcagcacttcgttcagaccatgcagcagcaggcccagcacgccatcgctactgaggac
cagcagcacaagcaggagctgcacaagctcatggcccgctgtttcctgaaactcggggag
tggcagctgaacctccagggcatcaacgagagcacgatccccaaagtcctgcagtactac
agtgccgccacggagcacgaccgcagctggtacaaggcctggcacgcgtgggcggtgatg
aacttcgaagctgtgctgcactacaaacatcagaaccaagcccgggacgagaagaagaag
ctgcgccacgccagcggggccaacatcaccaatgctgccaccgccgccaccacagcggcc
accgccaccgccaccgccaccagcaccgagggcagcaacagcgagagcgatgcggagagc
agcgagaacagccctacgccttctcctctgcagaagaaggtcaccgaggatttgtccaaa
accctcttgatgtacactgtgcctgccgtccagggcttcttccgttctatctccttgtca
cgaggcaacaacctccaggatacactcagagtcctcaccttatggtttgattatggtcac
tggccagatgtaaacgaagccttggtggaaggggtgaaagcgatccagattgacacttgg
ttacaggtcatacctcagctcattgcgagaattgatacgcccaggccgttggtggggcgc
ctcattcaccagcttctcacagacatcggtcggtaccacccgcaggccctcatctacccc
ctgaccgtggcttctaagtccacgaccacagcccgtcacaacgcagccaacaagatcctg
aagaacatgtgtgagcacagcaacaccctggtgcagcaggccatgatggtgagcgaggag
ctgatccgcgtggccatcctctggcacgagatgtggcacgaaggcctagaggaagcttct
cgtttgtactttggggagaggaacgtgaaaggcatgttcgaggtgctggagcccctgcac
gccatgatggaacggggaccccagactctgaaggaaacatcctttaaccaggcatacggt
cgagatttaatggaggcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaag
gacctgacccaggcctgggacctctattaccacgtgttcagacgcatctccaagcagctg
ccacagctcacatccctagagctgcagtacgtctcccccaaactcctgatgtgccgggac
ctggaattggcggtgccaggaacatacgaccccaaccagccgatcattcgcattcagtcc
atagcgccatctttgcaagtcatcacctccaagcagaggcctcggaagctgacgctgatg
ggcagcaacgggcatgagttcgttttccttctgaagggccatgaggacctgcggcaggac
gaacgcgtgatgcagctcttcggcctggtcaacacgctgctggccaacgaccccacctct
ctgcgcaagaacctcagcatccagagatatgcagtcattcctttatcgaccaactcgggc
ctcatcggctgggtcccccactgtgacacactgcatgccctcatccgggactacagagag
aagaagaaaatcctgctcaacattgagcatcgcatcatgttgcggatggctccggactac
gatcacctgaccctgatgcagaaggtcgaggtgtttgagcacgcagtcaacaacacggcg
ggggatgacctggccaagctgctgtggctcaaaagcccgagctccgaggtgtggtttgat
cgaagaaccaattacacccgctctttagcagtcatgtccatggtcggatatattttgggc
ctaggagacagacacccgtccaacctgatgctggaccggctgagcgggaagatcctgcac
attgactttggggactgctttgaggttgctatgaccagagaaaaattcccagagaagatt
ccatttagactaacaagaatgttgaccaatgctatggaggttactggcttggacggcaac
tacagaatcacatgccacacggtgatggaagtccttcgcgagcacaaggatagcgtcatg
gctgtgctggaagcctttgtctacgaccccttgctgaactggaggctgatggacacaaat
accaaaggcaacaagagatcccgaacaaggacagattcctactctgctggccagtcagta
gaaattttggatggtgtggaacttggggaaccagcccataagaaaacggggaccacagtg
ccagaatcgattcattctttcattggagatggtctggtcaaaccagaggccctgaacaag
aaagctattcagattattaacagagttcgagataagctcactggtcgggacttctctcac
gatgaaactttggatgtcccaacacaagtcgaactgctcatcaaacaagcaacatcccac
gagaacctctgccagtgctacattggctggtgccctttctggtaa

DBGET integrated database retrieval system