KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513162
Entry
107513162         CDS       T06036                                 

Gene name
NOS1
Definition
(RefSeq) LOW QUALITY PROTEIN: nitric oxide synthase, brain
  KO
K13240  nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00220  Arginine biosynthesis
ray00330  Arginine and proline metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04145  Phagosome
ray04371  Apelin signaling pathway
ray04713  Circadian entrainment
ray04730  Long-term depression
ray04926  Relaxin signaling pathway
ray04970  Salivary secretion
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107513162 (NOS1)
   00330 Arginine and proline metabolism
    107513162 (NOS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107513162 (NOS1)
   04020 Calcium signaling pathway
    107513162 (NOS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107513162 (NOS1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107513162 (NOS1)
  09154 Digestive system
   04970 Salivary secretion
    107513162 (NOS1)
  09156 Nervous system
   04730 Long-term depression
    107513162 (NOS1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107513162 (NOS1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107513162 (NOS1)
   05014 Amyotrophic lateral sclerosis
    107513162 (NOS1)
   05022 Pathways of neurodegeneration - multiple diseases
    107513162 (NOS1)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107513162 (NOS1)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 PDZ PDZ_6 PDZ_2 Flavodoxin_5
Other DBs
NCBI-GeneID: 107513162
NCBI-ProteinID: XP_016004995
LinkDB
Position
Unknown
AA seq 1434 aa
MENHTFSVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGQPLVDLAYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGPSSTAVDLSHQSSACKEQPVAVDRAPGPGNGLQHAHDNGQEAGSLSHTNGLAP
RPPSQFPAKRSAGVALQSGGEHNELLKEIEPVLNLLTGGGRGINGGAPAKVETKDAEVQV
DRDLDGKSHKPLPLGAENDRVFNDLWGKGNVPVVLNNPYSEKEQPPASGKQSPTKNGSPS
KCPRFLKVKNWETDVVLTDTLHLKSTLETGCSEHICMGSVIHAPQQVRRPEDVRTKEQLF
PLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIEVTSTYQLKDTELIYGAKHAWRNASRC
VGRIQWSKLQVFDARDCTTAHGMFNYICNHIKYATNKGNLRSAITIFPQRIDSKHDFRVW
NSQLIRYAGYKQPDGSILGDPASVELTEICVQQGWKPPRGRFDVLPLLLQANGNDPELFQ
IPPELVLEVPIRHPKLEWFEDLGLKWYGLPAVANMLLEIGGLEFSACPFSGWYMGTEIGV
RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT
ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHV
WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMARRVKATILYATETGKSQAYAKTLCE
IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVH
EERKSYKVRFNSVSSYSDARKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF
GHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN
SLISNDRSWKRNKFRLTYVAEAPELAQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFV
RLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPVNQLVKVELLEERTTALGV
ISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEQEKQRLLVLSKGLQEY
EEWKWGKNPTVVEVLEEFRSIQMPTTLLLTQLSLLQPRYYSISSSPDMYPEEVHLTVAIV
SYRTRDGEGPIHHGVCSSWLNRIQADEVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP
FRSFWQQRQFDIQHKGMSPCPMVLVFGCRQSKVDHIYREETLQARDTGVFRELYAAYSRE
PDKPKKYVQDILQEQLAETVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTRQGKLSVE
DAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDADEVFSS
NT seq 4305 nt   +upstreamnt  +downstreamnt
atggagaatcacacgttcagcgttcagcaaatccagcccaacgtgatttccgtccgactt
ttcaagcgcaaagtggggggcctggggttccttgtgaaggagcgggtgagcaagcccccc
gtgatcatttccgacctgattcgcgggggtgccgcggagcagagcggcctcatccaggcg
ggagacatcatcctcgcggtcaacgggcagcctttggtggacctggcttacgacagcgcc
ctggaggtgctgaggggcatcgcctccgagacccacgtggtcctcattctgaggggcccc
gagggcttcaccacgcacctggagaccaccttcacgggggacgggacccccaagaccatc
cgggtgacacagcccctgggtccctcctccacagccgtggacctgtcacaccagtcgtcg
gcctgcaaagagcagccagtggcagtggacagggccccaggtccaggtaacgggctgcag
catgcacacgacaacgggcaggaagcgggctcgctgtcccacaccaatggtctagctccc
aggcccccgagccagttccctgccaagagaagtgccggggtcgccctccagagcggtggg
gaacacaatgaactgctcaaagagatagagcctgtgctgaaccttctcaccggcggtggc
agagggatcaatggaggtgcacctgccaaggtggagacgaaagacgcagaggtccaggtg
gacagagatctggacggcaagtcacacaaaccgctgccccttggtgcggagaatgaccga
gtcttcaatgacctgtgggggaagggcaatgtgcccgtggtcctcaacaacccgtattca
gagaaggagcagccccccgcctcgggaaaacagtcccccacaaagaacggtagcccctcc
aagtgcccccgcttcctcaaggtcaagaactgggagactgacgtggttctcactgacacg
ctccaccttaagagcacattggaaacgggatgcagtgagcacatctgtatgggctccgtc
atacacgcacctcagcaggtgcgaaggcccgaagacgtccgcacgaaagaacagctcttc
cctctcgccaaagagtttattgatcagtactactcgtcgatcaaaagatttggctccaaa
gcccacatggagaggctggaagaggtgaacaaggagattgaagtcaccagcacctaccag
ctcaaggacacggagctcatctacggggccaagcacgcctggaggaacgcctcccgctgc
gtcggcaggatccagtggtccaagctgcaggtgtttgatgcccgcgactgcaccacggct
cacgggatgttcaactacatttgcaaccacatcaagtatgccaccaacaaagggaacctc
aggtctgcgatcaccatattcccgcagaggatcgacagcaagcatgatttccgagtctgg
aactcccagctcatccgctatgccggctacaagcagcccgacggctccatcctgggggat
ccagccagtgtggagctcacagagatctgcgtgcagcagggttggaaacccccaagaggc
cgcttcgatgtcctgccgctcctgctccaggccaatggcaacgaccccgagctctttcag
attcctccggagctggtgttggaagtgcccatcagacaccccaagttggagtggttcgag
gacctggggctgaagtggtatggcctccccgcagtggccaacatgcttctggagatcggt
ggcctggagttcagcgcctgtcccttcagcggctggtacatgggcacggagattggcgtc
cgcgactactgcgataactctcgctacaacatcctcgaggaagtggccaagaagatgaac
ttggacatgaggaagacgtcctccctgtggaaggaccaggcgctggtggagatcaacatc
gcagttctctacagcttccagagtgacaaagtgaccatcgtcgaccaccactctgccacc
gagtccttcattaagcacatggagaatgaataccgatgccgggggggctgcccggccgac
tgggtgtggatcgtgccccccatgtccggcagcatcacccccgtcttccaccaggagatg
ctcaactaccggctcaccccctccttcgagtaccagcctgacccttggaacacccatgtc
tggaaaggcaccaatgggacccccacaaagaggcgagccatcggcttcaagaagctggca
gaggctgtcaagttctcggccaagctgatggggcaggcaatggctagaagggtcaaggcg
accatcctttatgccacagagacaggcaaatcgcaggcctacgccaaaaccttgtgtgag
atcttcaaacacgcctttgacgccaaggtgatgtccatggaagaatatgacatcgtgcat
ctggaacacgaaactctggtcctggtcgtcaccagcaccttcggcaacggagacccgccc
gagaacggggagaaattcggctgtgctttgatggaaatgaggcaccccaactctgtgcat
gaggaaaggaagagctacaaggtcaggttcaatagcgtttcctcatattctgacgcccgc
aaatcatccggtgacgggcctgacctcagagacaactttgagagcgctggacccctggca
aatgtgaggttctcagtgttcgggctcggctcacgggcgtaccctcacttctgcgccttt
ggacatgccgtagacaccctcctagaagagctgggaggagagaggatcctgaagatgagg
gagggggacgagctctgtgggcaggaagaggctttcaggacctgggccaagaaggtcttc
aaggcagcctgcgatgtgttctgcgtgggggatgacgtcaacatcgagaaggcgaacaac
tctctcatcagcaatgatcgcagctggaagaggaacaagttccgcctcacctacgtggcc
gaagccccagaacttgcacaaggtctatccaacgtccacaaaaagcgggtctcggctgct
cgtctcctgagccgtcaaaaccttcagagtcctaaatccagccgatccaccatcttcgtg
cgtctgcacaccaatgggaatcaggagctgcagtaccagcccggcgaccacctgggtgtc
ttccctggcaatcacgaggacctcgtgaacgccttgatcgagcggctggaggatgcaccc
cccgtcaaccagctggtgaaggttgagctgctggaggagcggaccacagctttgggcgtt
atcagtaactggaccgacgagctccgcctcccgccctgcaccatcttccaggccttcaag
tactacttggacatcaccacgccccccacgccactgcagctgcagcagtttgcctcccta
gccaccagtgagcaagagaagcagcgtctgctggtcctcagcaagggcttgcaggagtat
gaggagtggaaatggggcaagaaccccaccgtcgtggaggtgctggaggagttccggtcc
atccagatgcccaccacgctgctcctgacccagctgtccctgctgcagcctcgctactac
tccatcagctcctccccggacatgtaccccgaggaggtgcacctgaccgtggccatcgtc
tcctaccgcacccgagatggagaaggaccaattcaccacggcgtgtgctcctcctggctc
aaccggatacaggctgacgaagtggtcccctgcttcgtgagaggagcacccagcttccac
ctgccccgaaacccccaagtgccctgcatcctggtcggccccggcactgggatcgcccct
tttcgaagcttctggcagcaacggcagtttgatatccaacacaaaggaatgagcccttgc
cccatggtcctggtcttcgggtgccggcaatccaaggtagatcatatctacagggaggag
accctacaggccagggacacaggcgtcttcagagaactatacgcggcctactcccgcgag
ccagacaaaccaaagaagtacgtacaggatatcctgcaagagcagctggcggaaactgtg
taccgagccctgaaggagcaagggggccacatttacgtctgtggggatgtcaccatggcc
gccgacgtcctcaaagccatccagcgcatcatgacccggcaggggaagctctcggtggag
gacgccggcgtgttcatcagccgcctgagggatgacaaccgctaccatgaggatattttc
ggggtcactctgcgaacatatgaagtgaccaaccgccttagatctgaatccattgccttc
atcgaagagagcaaaaaagacgccgatgaggtttttagctcctaa

DBGET integrated database retrieval system