KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513216
Entry
107513216         CDS       T06036                                 

Gene name
CTSD
Definition
(RefSeq) cathepsin D
  KO
K01379  cathepsin D [EC:3.4.23.5]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04071  Sphingolipid signaling pathway
ray04140  Autophagy - animal
ray04142  Lysosome
ray04210  Apoptosis
ray04915  Estrogen signaling pathway
ray05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107513216 (CTSD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107513216 (CTSD)
   04140 Autophagy - animal
    107513216 (CTSD)
  09143 Cell growth and death
   04210 Apoptosis
    107513216 (CTSD)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107513216 (CTSD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107513216 (CTSD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ray01002]
    107513216 (CTSD)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107513216 (CTSD)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.5  cathepsin D
     107513216 (CTSD)
Peptidases and inhibitors [BR:ray01002]
 Aspartic peptidases
  Family A1: pepsin family
   107513216 (CTSD)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107513216 (CTSD)
SSDB
Motif
Pfam: Asp TAXi_N TAXi_C
Other DBs
NCBI-GeneID: 107513216
NCBI-ProteinID: XP_016005123
LinkDB
Position
Unknown
AA seq 375 aa
MSEVGGPVEDLIAKGPISKYAQGMPAVSGGPIPEMLKNYMDAQYYGEIGIGTPPQCFTVV
FDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTYVKNGTAFDIHYGSGSLSGYLSQDT
VSVPCNSAPSAPGGVRVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDN
LMQQKLVDKNIFSFYLNRDPNAQPGGELMLGGTDSKYYTGSLSYLNVTRKAYWQVHMEQV
DVGNSLTLCKAGCEAIVDTGTSLVVGPVEEVRALQKAIGAVPLIQGEYMIPCEKVSSLPE
VTLKLGGKGYKLGAEDYTLKVSQGGKTICLSGFMGMDIPPPGGPLWILGDVFIGRYYTVF
DRDENRVGLAEATRL
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtcggaggtgggggggcccgtggaagacctcatcgccaaaggccccatttcgaaatac
gcccaggggatgcctgctgtgagcgggggaccgatccccgagatgctcaagaattacatg
gatgcccagtactatggggagatcggcatcgggacacccccacagtgcttcacggttgtc
ttcgacaccggctcctccaacctgtgggtcccgtccatccactgcaagctgctggacatc
gcctgctggatccaccacaagtacaacagcggcaagtccagcacctacgtgaagaacggc
accgccttcgacatccactacggctcgggcagcctctcggggtacctgagccaggacacc
gtgtcggtgccctgtaactcggccccgtcggcgccgggcggcgtccgggtggagagacag
gtcttcggggaggccaccaagcagccgggcatcaccttcatcgcggccaagttcgacggc
atcctgggcatggcctacccccgcatctcggtcaacaacgtgctgcccgtcttcgacaac
ctgatgcagcagaagctggtggacaagaacatcttctccttctacctgaacagggaccct
aacgcgcagccggggggcgagctgatgctgggcgggaccgactccaagtactacacgggc
tccctgagctacctgaacgtcacccgcaaggcctactggcaggtgcacatggagcaggtg
gacgtggggaacagcctgaccctgtgcaaggccggctgcgaggccatcgtggacacaggc
acgtccctcgtggtgggccccgtggaggaggtgcgtgccctgcagaaggccatcggggcc
gtgccgctgatccagggcgagtacatgatcccctgcgagaaggtgtccagcctgcccgag
gtcaccctgaagctgggaggcaaaggctacaagctgggcgcagaggactacacactcaag
gtgtcacagggggggaagaccatctgcctgagcggcttcatgggcatggacatccccccg
cctggcgggccactctggatcctgggcgacgtcttcatcgggcgctactacaccgtcttt
gaccgcgacgagaaccgcgtgggcctggccgaggccacccgtctgtag

DBGET integrated database retrieval system