KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513248
Entry
107513248         CDS       T06036                                 

Gene name
MYL2
Definition
(RefSeq) myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  KO
K10351  myosin regulatory light chain 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04371  Apelin signaling pathway
ray04510  Focal adhesion
ray04530  Tight junction
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray05132  Salmonella infection
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107513248 (MYL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107513248 (MYL2)
   04530 Tight junction
    107513248 (MYL2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107513248 (MYL2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107513248 (MYL2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107513248 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    107513248 (MYL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107513248 (MYL2)
   05414 Dilated cardiomyopathy
    107513248 (MYL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107513248 (MYL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513248 (MYL2)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107513248 (MYL2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 107513248
NCBI-ProteinID: XP_016005175
LinkDB
Position
Unknown
AA seq 166 aa
MAPKKAKKRAEGANSNVFTMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDDMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYIK
EMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcacccaagaaagccaagaagagggcggaaggtgccaattccaacgtgttcaccatg
ttcgaacagacccagatccaggaatttaaggaggccttcaccatcatggaccagaacagg
gatggcttcatcgacaagaacgatctccgggacacctttgctgctctcgggcgtgtgaat
gtgaaaaatgaggaaatcgacgacatgataaaggaagctccaggtcccattaactttacg
gtgttcctaacgatgtttggggagaaactgaagggggcagaccccgaggagaccattctc
aatgcgttcaaagtgtttgatcctgaaggcaaaggggtgctcaaggcggattacattaag
gagatgctgaccacgcaggcggagagattttccaaggaggagattgaccagatgttcgcc
gccttcccccccgacgtgaccggcaacttggactataagaacctggtgcacatcatcacc
cacggagaagaaaaggactga

DBGET integrated database retrieval system