KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513269
Entry
107513269         CDS       T06036                                 

Gene name
INS
Definition
(RefSeq) insulin isoform X1
  KO
K04526  insulin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04911  Insulin secretion
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04917  Prolactin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04940  Type I diabetes mellitus
ray04950  Maturity onset diabetes of the young
ray04960  Aldosterone-regulated sodium reabsorption
ray05010  Alzheimer disease
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107513269 (INS)
   04014 Ras signaling pathway
    107513269 (INS)
   04015 Rap1 signaling pathway
    107513269 (INS)
   04066 HIF-1 signaling pathway
    107513269 (INS)
   04068 FoxO signaling pathway
    107513269 (INS)
   04072 Phospholipase D signaling pathway
    107513269 (INS)
   04022 cGMP-PKG signaling pathway
    107513269 (INS)
   04151 PI3K-Akt signaling pathway
    107513269 (INS)
   04152 AMPK signaling pathway
    107513269 (INS)
   04150 mTOR signaling pathway
    107513269 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107513269 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107513269 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107513269 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107513269 (INS)
   04910 Insulin signaling pathway
    107513269 (INS)
   04923 Regulation of lipolysis in adipocytes
    107513269 (INS)
   04913 Ovarian steroidogenesis
    107513269 (INS)
   04914 Progesterone-mediated oocyte maturation
    107513269 (INS)
   04917 Prolactin signaling pathway
    107513269 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107513269 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    107513269 (INS)
   04213 Longevity regulating pathway - multiple species
    107513269 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    107513269 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107513269 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107513269 (INS)
   04940 Type I diabetes mellitus
    107513269 (INS)
   04950 Maturity onset diabetes of the young
    107513269 (INS)
   04932 Non-alcoholic fatty liver disease
    107513269 (INS)
   04931 Insulin resistance
    107513269 (INS)
SSDB
Motif
Pfam: Insulin Ins_beta Tr-sialidase_C
Other DBs
NCBI-GeneID: 107513269
NCBI-ProteinID: XP_016005239
LinkDB
Position
Unknown
AA seq 112 aa
MALWTRLLPLLALLGLWAPAAAPAFVTQHLCGSHLVEALYVVCGERGFFYSPKVRREAGD
PQAEEVELELDEGPGTSSPQTLALDGPRQKRGIVDQCCTSICSLYQLENYCN
NT seq 339 nt   +upstreamnt  +downstreamnt
atggccctgtggacgcgcctcctgcccctgctggccctgctgggcctctgggctcccgcg
gcggccccggcctttgtcacccagcacctgtgcggctcccacctggtggaggcgctgtac
gtggtgtgcggggaacgtggcttcttctactcgcccaaggtccgccgcgaggcgggggac
ccgcaggcagaggaggtagagctggagctggacgagggccccggcaccagcagcccgcag
accctggccctggacgggccccggcagaagcgcggcatcgtggaccagtgctgcaccagc
atctgctcgctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system