KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513286
Entry
107513286         CDS       T06036                                 

Gene name
PDE1A
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A isoform X1
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04740  Olfactory transduction
ray04742  Taste transduction
ray04924  Renin secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107513286 (PDE1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107513286 (PDE1A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107513286 (PDE1A)
  09157 Sensory system
   04740 Olfactory transduction
    107513286 (PDE1A)
   04742 Taste transduction
    107513286 (PDE1A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107513286 (PDE1A)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107513286 (PDE1A)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 107513286
NCBI-ProteinID: XP_016005270
LinkDB
Position
Unknown
AA seq 554 aa
MWSIIMGSTTTDIEELENTTFKYLIGEHTEKMWQRLKGILRCLVKQLERGDVNVVDLKKN
IEYAASVLEAVYIDETRRLLDTDDELGDIQSDAVPLEVRDWLASTFTRKMGMIKKKSEEK
PKFRSIVHAVQAGIFVERMYRKTYQMVGLTYPEAVIITLKDVDKWSFDVFALNKASGEHS
LKFMIYELFTRYDLINRFKIPVSCLIAFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIM
LHTGIMHWLTELEILAMVFAAAIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSA
AYRLMQEEEMNVLVNLSKDDWRDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGINRA
KTMSLILHAADISHPAKCWQLHHRWTMALMEEFFRQGDKEAELGLPFSPLCDRNSTIVAQ
SQIGFIDFIVEPTFSLLTDSTERIIIPLIEEDSKTKNSSYGANRRSNMKGTMNEGTYSPD
YSLASVDLKSFKNNLMDIIQQNKERWKELAVQGIVVYEDLLPYLYDEFGFFPLDFLFFFF
FFNTIGKPLLVFGI
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgtggagtatcatcatggggtctactactacagatatcgaagaactggaaaacaccact
tttaagtatcttataggagaacacactgaaaaaatgtggcaacgcttgaaaggaatacta
agatgcttagtgaagcagctggaaagaggtgatgtcaacgttgtagacttaaagaagaac
attgaatatgcagcatctgtattggaagcagtttatattgatgaaacaagaagactactc
gataccgacgatgagcttggggacattcagtcggatgcagttccattggaagttcgggac
tggttggcttctacctttacacggaaaatggggatgataaaaaagaaatctgaggaaaaa
ccaaaatttcggagcattgtgcatgctgttcaagctgggatttttgtggaaaggatgtac
agaaagacctatcagatggttggtttgacatatccagaggctgtcataataacattaaag
gatgttgataaatggtcttttgatgtatttgccttaaataaagcaagcggagaacatagt
ctgaagtttatgatttatgaactatttaccagatatgatcttatcaaccgtttcaagatt
cctgtttcttgcctaattgccttcgcagaagctttagaagttggttacagcaagtacaaa
aatccttatcacaacctgattcatgcagccgatgtcactcaaactgtgcattacataatg
cttcatacaggtatcatgcactggctcactgaactggaaattttagcaatggtctttgcg
gctgccattcatgattatgaacatacaggaaccacaaacaactttcacattcagacaagg
tcagatgttgccattttatataatgatcgatctgtccttgagaatcaccatgtgagtgca
gcttatcgacttatgcaagaagaagaaatgaatgtcttggtaaatttatccaaagatgac
tggagggatcttcggaacctggtgattgaaatggttttgtctacagacatgtcaggtcac
ttccagcaaattaaaaatataagaaacagtttgcagcagcctgaagggatcaacagagcc
aaaaccatgtccctgattctccatgcagcagacatcagccacccagccaaatgctggcag
ctgcaccaccggtggaccatggccctgatggaggagttcttccgacagggagataaagaa
gctgaattaggacttccattttccccgctttgtgatcggaattcaacaatcgtggctcag
tcacaaataggttttattgatttcatagtagagccaacattttctcttctgacagactca
acagagagaattattattcctcttatagaggaagattcaaaaaccaaaaattcttcctat
ggggcaaacagacgatcaaatatgaaaggcaccatgaacgaaggcacctattccccagac
tactcccttgcaagtgtggacctgaagagcttcaaaaacaacctgatggacatcatccag
cagaacaaagaaagatggaaagagttagctgtgcaaggtatagttgtttatgaagactta
ctgccatatctttatgatgaatttggatttttccccctagatttcctttttttctttttt
ttttttaatacaataggaaagcccttgctggtatttggaatttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518500
Entry
107518500         CDS       T06036                                 

Gene name
PDE1C
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C isoform X1
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04740  Olfactory transduction
ray04742  Taste transduction
ray04924  Renin secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107518500 (PDE1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107518500 (PDE1C)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107518500 (PDE1C)
  09157 Sensory system
   04740 Olfactory transduction
    107518500 (PDE1C)
   04742 Taste transduction
    107518500 (PDE1C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107518500 (PDE1C)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107518500 (PDE1C)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N BSP_II
Other DBs
NCBI-GeneID: 107518500
NCBI-ProteinID: XP_016015709
LinkDB
Position
Unknown
AA seq 767 aa
MEKCAERSRGDRWRENPGSTHGPVPVIAQPDVPSVANEAGDKTARPLARFSRSKSQNCLW
NSLIDGLTGNVKEKTRPTIVPDPRPPEEILADELPQLDSPEALVKTSFRLRSLVKQLERG
EASVVDLKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQM
GMMLRRSEEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVF
SLNEASGDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAA
DVTQTVHYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDR
SVLENHHLSAAYRLLQEDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKT
ALQQPEAIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSP
LCDRKSTMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSIS
STEAKRSGVKSAGSEGNAPINNSVIPVDYKSFKATWTEVVHVNRERWRAKVPKEEKAKKE
AEEKARLAAEEKQKEMEAKQQAEEGAPGKAQSQVNGTHPNKSDNPRGKNSKAGKSSGEKQ
QNGDLKDGKNKADKKDQSNVGNDSKKTDGTKKRSHGSPAPSTGSTSRLTLPVIKPPLRHF
KRPAYASSSYAPSVPKKTEEHPARYKMLDQRIKMKKIQNISHNWNRK
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggaaaagtgtgcagagaggagcagaggtgaccgatggagggagaaccctggcagcacg
catggtcccgttccggtcatagcccagcccgatgtcccctcagttgcaaacgaagctgga
gacaagaccgccagacctctcgcccgcttctcccgatctaagtcacaaaactgtctgtgg
aactccctcattgacgggctcacggggaatgtcaaagagaagacacggccaacaattgtc
ccggaccctcgaccaccggaggaaatcctggcggatgaactgcctcagctcgatagcccc
gaagccttggtgaagacatccttcaggttacggtctttggtcaaacaattagagagaggg
gaggcttcagtggtagatcttaagaagaatttggaatatgcagccacagtgcttgagtct
gtatacattgatgaaaccaggcgactcctggatacggaggatgagctcagtgacattcag
tcagatgcggtgccttctgaggtccgagactggctggcctccaccttcacgcggcagatg
gggatgatgctgaggaggagcgaggagaagccgcggttcaagagcatcgtgcacgcagtg
caggctgggatatttgtggagagaatgtatagacggacatcaaacatggttggactgagc
tatccaccagctgttattgaagcgttaaaggatgtggacaagtggtcctttgatgtcttt
tctctcaatgaagccagtggggatcacgcactgaaattcattttctatgaattactcaca
cgttatgatctgatcagccgtttcaagatccccatttccgcactcgtctcgtttgtggag
gccttggaagtgggctacagcaagcataagaatccttaccacaatttaatgcatgcggcc
gatgtcacgcagacagtgcattacctcctctacaagacaggagtggcgaactggctgacg
gagctggagatttttgctataatcttctcagctgccatccatgactatgagcacaccgga
accaccaacaatttccacattcagacccgatccgacccagccattctgtacaacgatagg
tctgtactggaaaatcaccatttaagtgcagcttatcgccttcttcaagaggatgaggaa
atgaatattttgatcaacctctcaaaggatgactggagggaatttcggaccttggtaatt
gagatggtgatggccacggatatgtcctgtcatttccagcaaatcaaagcgatgaaaact
gctctgcagcagccagaagcaattgagaagccaaaagcattatcactgatgttgcacaca
gcagacattagccatccagcaaaagcatgggatctccatcatcgctggaccatgtcgctc
ttggaggaattctttagacagggtgacagagaagcagagctggggctgcctttttctcct
ctatgtgaccgaaagtcgaccatggttgcccagtcacaagtaggatttattgatttcatc
gtggagcccaccttcaccgtgctcacggacatgaccgagaagattgtgagtccgttaatt
gatgaaacttcccagactggtgggactggacagagacgatcaagtttgaacagcatcagt
tcaacagaagcaaagcgatcaggtgtcaagagcgccggctcagaaggaaacgccccgatc
aacaattccgtcatccctgttgactacaagagttttaaagccacttggactgaggtggtg
cacgtcaatcgggagcgatggagggccaaggtgcccaaagaggagaaggccaagaaggaa
gccgaggagaaggcccgcctggctgcagaagagaagcaaaaggaaatggaagccaaacaa
caagccgaggagggcgcgcctggcaaagcgcagagtcaagtcaatggaacgcacccgaac
aaaagcgacaaccctcgcgggaaaaactccaaagccgggaagtcatccggggaaaagcaa
cagaatggtgacttgaaagatggtaaaaataaagcagacaagaaggatcaatctaatgtc
ggaaatgattcaaagaaaacagatggcacaaagaagcgttctcacggctcaccagctcca
agcactggctccacaagtcgcctcaccttgccagtcatcaagcctcctctgcgacacttt
aaacgccccgcttatgcatctagctcctacgcaccttccgtcccaaagaagactgaggag
catcctgcgaggtacaagatgctggatcagagaatcaaaatgaaaaagattcagaacatc
tcacataactggaacagaaaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521071
Entry
107521071         CDS       T06036                                 

Gene name
PDE1B
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B isoform X1
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04740  Olfactory transduction
ray04742  Taste transduction
ray04924  Renin secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107521071 (PDE1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107521071 (PDE1B)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107521071 (PDE1B)
  09157 Sensory system
   04740 Olfactory transduction
    107521071 (PDE1B)
   04742 Taste transduction
    107521071 (PDE1B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107521071 (PDE1B)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107521071 (PDE1B)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N La_HTH_kDCL
Other DBs
NCBI-GeneID: 107521071
NCBI-ProteinID: XP_016020954
LinkDB
Position
Unknown
AA seq 535 aa
MELSPRSPPEMLESDCPLPLELKSAPSKKMWIKLRSLLRYMVKQLENGEVNIEELKKNLE
YTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPK
FRSIVHAVQAGIFVERMFRRTYTSVGPTHSTAVLKCLKNLDLWCFDVFSLNQAADDHALR
TIVFELLTRHNLISRFKIPTVFLMTFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLR
TGMVHCLSEIEVLAIIFAAAIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSVF
RMMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKSMKTALQQLERIDKSKA
LSLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQ
IGFIDFIVEPTFSVLTDVAEKSVQPLGDEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSF
RSTWTKYIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPTEDEHNQNGNLD
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggagctgtcccctcgaagccctcccgagatgctggagtcagattgcccgttgcccctg
gagctgaagtcagctcccagcaagaagatgtggattaagcttcggtcgctgctacgctac
atggtgaagcaattggagaatggggaggtcaacattgaggagctgaagaaaaacttggag
tacacagcttccctactggaggccgtctatatagatgagactcggcaaatcttggacacg
gaggacgagttgcaggagcttcggtcagatgctgtgccttccgaggtgcgggactggctg
gcctccaccttcacccagcaggcccgggccaaaggccgacgggcagaggagaagcccaag
ttccgcagcatagtgcacgctgtgcaggccgggatcttcgtggaacggatgttccggaga
acatacacctcggtgggccccactcattccactgcggtcctcaagtgtctcaagaacctg
gacctctggtgcttcgatgtcttttccttgaaccaggcagcagatgaccacgccctgagg
accattgtctttgagttgctgactcggcataacctcatcagccgctttaagattcccact
gtgtttttgatgactttcctggatgcattggagacaggctatgggaagtacaagaaccct
taccataaccagatccatgccgctgatgttacccagacagtccattgcttcttgctccgc
acagggatggtgcactgcctgtcagagattgaggtcttggccatcatctttgcagcagcc
attcatgactatgagcacacgggcacgaccaacagcttccatatccagaccaagtcagaa
tgtgccatcctatacaatgatcgctcagtactggagaatcaccacatcagttctgttttc
cgaatgatgcaggatgacgagatgaacattttcatcaacttaaccaaggatgagtttgta
gaactgcgggccctggtcatcgagatggtgttggccacagacatgtcttgccatttccag
caagtgaagtccatgaagacagccttgcagcagctggagaggattgacaagtccaaggcc
ctgtctctactgctccatgctgctgacatcagccacccaactaagcagtggtcggttcac
agccgctggaccaaggctctcatggaggaattcttccgccagggcgacaaggaggcagaa
ctgggcctgccattttctccactgtgtgatcgcacttccactctcgtggcacagtcccag
attggtttcattgacttcattgtggagcccacattctctgtgctaactgatgtggctgag
aagagtgtccagcccctgggggatgaggactccaagtctaaaaaccagcccagcttccag
tggcgccagccttctctggacgtggaagtgggagaccccaaccctgatgtggtcagcttc
cgctccacctggaccaaatacattcaggagaacaagcagaaatggaaggaacgggcagca
agtggcatcaccaaccagatgtccattgacgagctgtctccctgtgaggaggaagcccca
ccctcccccactgaagatgaacacaaccagaatgggaatctggactag

DBGET integrated database retrieval system