KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513294
Entry
107513294         CDS       T06036                                 

Gene name
CAMP
Definition
(RefSeq) cathelicidin antimicrobial peptide
  KO
K13916  cathelicidin antimicrobial peptide
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04621  NOD-like receptor signaling pathway
ray04970  Salivary secretion
ray05150  Staphylococcus aureus infection
ray05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107513294 (CAMP)
  09154 Digestive system
   04970 Salivary secretion
    107513294 (CAMP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    107513294 (CAMP)
   05152 Tuberculosis
    107513294 (CAMP)
SSDB
Motif
Pfam: Cathelicidins CAP18_C Spp-24
Other DBs
NCBI-GeneID: 107513294
NCBI-ProteinID: XP_016005286
LinkDB
Position
Unknown
AA seq 132 aa
MPRGCTLGDLGRQIREGKREPKPSLPTFSFGQEKDKNTPRPVSFRVKETVCPRTTRQVPE
QCDFKENGLVKQCVGTVTLDRVNGYFDINCAELQGVRGLGDLIRRGGRKIGEGIEGLGRR
IKGLFSSLESRK
NT seq 399 nt   +upstreamnt  +downstreamnt
atgccgagaggctgcactcttggtgatcttgggagacagatcagggaaggcaagcgggag
cccaagcccagtctccccactttttcctttggccaggaaaaggacaaaaacaccccgagg
cctgtgagcttcagggtgaaggagactgtgtgccccaggacgacacggcaggtgccggag
cagtgtgatttcaaggagaatgggctggtgaaacagtgtgtggggacagtcaccctggac
cgggtcaatggctactttgacatcaactgtgcggagctccagggtgtcagagggcttggc
gatctcatccggagaggtgggcggaagatcggcgaagggatcgaaggacttggccgtagg
atcaagggcttgttttcgagtcttgagtccagaaaatag

DBGET integrated database retrieval system