KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513350
Entry
107513350         CDS       T06036                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04144  Endocytosis
ray04150  mTOR signaling pathway
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04350  TGF-beta signaling pathway
ray04360  Axon guidance
ray04510  Focal adhesion
ray04520  Adherens junction
ray04530  Tight junction
ray04611  Platelet activation
ray04621  NOD-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04660  T cell receptor signaling pathway
ray04670  Leukocyte transendothelial migration
ray04722  Neurotrophin signaling pathway
ray04810  Regulation of actin cytoskeleton
ray04921  Oxytocin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04972  Pancreatic secretion
ray05100  Bacterial invasion of epithelial cells
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05152  Tuberculosis
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107513350 (RHOA)
   04015 Rap1 signaling pathway
    107513350 (RHOA)
   04310 Wnt signaling pathway
    107513350 (RHOA)
   04350 TGF-beta signaling pathway
    107513350 (RHOA)
   04072 Phospholipase D signaling pathway
    107513350 (RHOA)
   04071 Sphingolipid signaling pathway
    107513350 (RHOA)
   04024 cAMP signaling pathway
    107513350 (RHOA)
   04022 cGMP-PKG signaling pathway
    107513350 (RHOA)
   04150 mTOR signaling pathway
    107513350 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107513350 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107513350 (RHOA)
   04520 Adherens junction
    107513350 (RHOA)
   04530 Tight junction
    107513350 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107513350 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107513350 (RHOA)
   04621 NOD-like receptor signaling pathway
    107513350 (RHOA)
   04625 C-type lectin receptor signaling pathway
    107513350 (RHOA)
   04660 T cell receptor signaling pathway
    107513350 (RHOA)
   04670 Leukocyte transendothelial migration
    107513350 (RHOA)
   04062 Chemokine signaling pathway
    107513350 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107513350 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    107513350 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107513350 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    107513350 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107513350 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    107513350 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513350 (RHOA)
   05206 MicroRNAs in cancer
    107513350 (RHOA)
   05205 Proteoglycans in cancer
    107513350 (RHOA)
   05203 Viral carcinogenesis
    107513350 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107513350 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107513350 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107513350 (RHOA)
   05135 Yersinia infection
    107513350 (RHOA)
   05133 Pertussis
    107513350 (RHOA)
   05152 Tuberculosis
    107513350 (RHOA)
   05100 Bacterial invasion of epithelial cells
    107513350 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107513350 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107513350 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107513350 (RHOA)
   04031 GTP-binding proteins [BR:ray04031]
    107513350 (RHOA)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107513350 (RHOA)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107513350 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   107513350 (RHOA)
  Exosomal proteins of colorectal cancer cells
   107513350 (RHOA)
  Exosomal proteins of bladder cancer cells
   107513350 (RHOA)
GTP-binding proteins [BR:ray04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107513350 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107513350
NCBI-ProteinID: XP_016005422
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatcaggaagaaattggtgattgttggtgatggagcctgtggcaagacctgc
ttgcttatcgtttttagcaaggaccagtttccagaggtgtatgtacccacagtgtttgag
aactatgtggcagatatcgaagtggatggaaagcaggtagaattggctttgtgggacaca
gctgggcaggaagattatgatcgcttgaggcccctctcctacccggacactgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccggaagtcaagcatttctgtcccaatgtgcccatcatcctggttgggaacaagaaggac
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtaaaa
ccagaagaaggcagagatatggcgaacaggattggcgcttttgggtacatggagtgttca
gcaaaaaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system