KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513352
Entry
107513352         CDS       T06036                                 

Gene name
DAG1
Definition
(RefSeq) dystroglycan
  KO
K06265  dystroglycan 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04512  ECM-receptor interaction
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107513352 (DAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107513352 (DAG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107513352 (DAG1)
   05414 Dilated cardiomyopathy
    107513352 (DAG1)
   05416 Viral myocarditis
    107513352 (DAG1)
SSDB
Motif
Pfam: a_DG1_N2 DAG1 He_PIG
Other DBs
NCBI-GeneID: 107513352
NCBI-ProteinID: XP_016005425
LinkDB
Position
Unknown
AA seq 745 aa
MSMSTGLSLLLPLWGRTFLLLLFAAVTQSHWPREPSEAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVAIPTDLIASNGEVIKVSAAGKEALPSWLHWDPQSHTLEGL
PLDTDKGVHYIAVSAARLGANGSHVPQTSSVFSIEVYPEDHSELQSLRAASPDPGEVLSS
ACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMQSFSEVELHSMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWRLGCSLSQNSVPDIRGVEAPAKEGTMSAQLGYPVVGWHIA
NKKPSLPKRIRRQIHATPTPVTALGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP
TTTTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRATTKAPITRLETASPPTRI
RTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDKEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQ
GDRAPARFKAKFVGEPAPVVNDIHKKIALVKKLAFAFGDRNCSTVTLQNITQGSIVVEWT
NNTLPLAPCPKEQITGLSRRIAEDDGKPRATFSNALEPDFKALSVAVTGSGSCRRLQFIP
VAPPRRVPSEAPPTEVQIGCQMQGP
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgagcatgtccacgggcctctcgctgctgctccccctctgggggaggacctttctcctc
ctgctcttcgcggccgtgactcagtcccactggcccagggaaccttcggaggccgtcagg
gactgggagaaccagctcgaggcgtccatgcactcggtgctctcagacctccatgaggct
gttcccacggtggtcggcattcctgatggcacagctgttgtcgggcgctcgtttcgagtg
gccattcccacagatttaattgcctccaatggagaagtcatcaaggtgtcagctgcgggg
aaggaggccttgccgtcctggctgcattgggacccccagagccacaccctggagggcctc
ccgcttgacaccgataagggcgtgcattacattgcagtgagtgctgcacggctgggggcc
aacgggagccacgtcccccagacctccagtgtgttctccatcgaggtctatcctgaagac
cacagcgagctgcagtccctgcgcgcagcgtcaccagaccctggcgaggtgctgtcgtct
gcttgtgctgccgacgagcctgtgactgtcctgacggtaattctggatgctgacctcacc
aagatgaccccaaagcaaaggatcgacctcctgcacagaatgcagagcttctcagaagtg
gagcttcacagcatgaagctggtgccggtggtgaataaccggctgttcgacatgtccgcc
ttcatggccggcccaggaaatgcaaaaaaggtggtagagaatggggccctgctctcctgg
aggctgggctgctccctgagccagaacagcgtgcctgacattcgtggtgtggaggcccct
gccaaggagggcactatgtctgcccagctcggctaccccgtggtgggctggcatatcgcc
aacaagaagccctctctccccaaacgcatccgaaggcagatccatgccacacccacgcct
gtcactgcccttgggcccccaaccacggccatccaggagccaccgtctaggatcgtaccc
actcccacatctccagccattgctcctccaacagagactatggctcctccagtcagggac
cctgttcctgggaagcccaccgtcaccattcggactcgaggtgccatcattcagacccca
accttaggccccatccagcccactcgggtgtcagaagctggcaccacggttcctggccag
atccgcccaacgatgaccattcccggctacgtggagcccacggcggtcgctacccctccc
acgactaccaccaagaagccacgagtctccacgccaaaaccagccacgccttctacagac
tcctcaaccaccacgactcgaaggccgaccaagaagccgcgcacaccccgaccggtgccc
cgggccacaacgaaagcgcccatcaccagactggagacggcctccccgcccactcgcata
cgcaccaccaccagcggggtgccccgtggaggagaacccaaccagcggccagagctcaag
aaccacatcgacagggtggacgcctgggttggcacctattttgaggtgaagatcccatca
gacaccttctatgacaaggaggacaccaccactgataagctgaagctgaccctgaagctt
cgggagcagcagctggtcggcgagaagtcgtgggtgcagttcaacagcaacagccagctc
atgtacggcctgcccgacagcagccacgtgggcaagcacgagtacttcatgcacgccacc
gacaaggggggcctgtctgctgtcgatgcctttgagatccatgtgcacaagcgccctcaa
ggggacagggctcccgcgcggttcaaggccaagtttgtgggtgagccagcaccagtggtg
aacgacatccacaagaagattgccctggtgaagaagctggccttcgcctttggggaccgc
aactgcagcaccgtcactctgcagaatatcacccagggctccatcgtggtggaatggacc
aacaacacgctgcctctggcgccctgccccaaggagcagatcacggggctgagccggagg
atcgctgaggatgacgggaaacctcgggccaccttctccaatgccttggagcccgacttc
aaggccttgagcgtcgctgtgacaggctccggtagctgccggcgcctacagtttatccct
gtggcgccccccaggagagtgccctcggaggcaccgcccacagaggtgcagatagggtgc
cagatgcagggaccctga

DBGET integrated database retrieval system