KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513375
Entry
107513375         CDS       T06036                                 

Gene name
SLC38A3
Definition
(RefSeq) sodium-coupled neutral amino acid transporter 3
  KO
K13576  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04724  Glutamatergic synapse
ray04727  GABAergic synapse
ray04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    107513375 (SLC38A3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107513375 (SLC38A3)
   04727 GABAergic synapse
    107513375 (SLC38A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107513375 (SLC38A3)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   107513375 (SLC38A3)
SSDB
Motif
Pfam: Aa_trans DUF3262
Other DBs
NCBI-GeneID: 107513375
NCBI-ProteinID: XP_016005483
LinkDB
Position
Unknown
AA seq 525 aa
MASTSECIAVRASTPGGVPEPWRHLCRRRWWSWCPTANTRRGRTRSPPPQQATRGTRAPD
GAGVEGEGFLQKSPGKEPHFTDFEGKTSFGVSVFNLSNAIMGSGILGLAFAMANTGIILF
LFLLTAVALLSSYSIHLLLKSSGVVGIRAYEQLGYRAFGTPGKLAAALAITLQNIGAMSS
YLYIIKSELPLVIQSFLNLEEETSNWYLNGNYLVILVSVTVILPLALMRQLGYLGYSSGF
SLSCMVFFLIAVIYKKFHVPCPLPPHFVNVTGNISLGESIKEETHLQGETDAVAFCTPRY
FTLNIQTAYTIPIMAFAFVCHPEVLPIYTELKDPSKTKMQRISNLSIAVMYVMYFLAALF
GYLTFYDGVESELLHTYSKVDPFDVLILCVRVAVLTAVTLTVPIVLFPVRRAIQQMMFQS
REFSWLRHALIAISLLTGINLLVIFAPNILGIFGIIGATSAPCLIFIFPAIFYFRIMPTE
KEPARSTPKILALCFAVLGFLLMTMSLSFIIIDWVSGTSQHEGSH
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggcttctacttctgagtgcatcgctgtgcgagccagcactcccggtggggtccccgaa
ccatggaggcacctctgcagacggagatggtggagctggtgcccaacggcaaacactcgg
aggggccgcacccggtcaccacccccgcagcaggcaaccagagggacgagggcccccgac
ggagccggtgtggagggcgagggcttcctacagaaaagccccggcaaggagccacacttc
acggattttgaggggaagacatcgtttggggtgtcggtgttcaacctcagcaacgccatc
atgggcagcggcatcctggggctcgccttcgccatggccaacacgggcatcatcctcttc
ctgttcctgctgacggctgttgccctgctctccagctactccatccacctgctgctcaag
tcctcaggggtcgtcggcatccgtgcctacgagcagctgggctaccgtgccttcgggacc
ccgggaaagctggcggcggccctggccatcaccctgcagaacatcggagccatgtccagc
tacctgtacatcatcaagtccgagctgccccttgtcatacagagcttcctgaacctggag
gaggaaacttcgaactggtacctaaacgggaactacctggtgattctggtgtctgtcacc
gtcattctgcccctggcgctgatgcggcagcttggctacctggggtactccagcggcttc
tctctcagctgcatggtgttcttcctaatcgcagtcatctacaaaaagttccatgtgccc
tgcccgctgcccccccactttgtcaacgtcacaggcaacatcagcctaggggagtccatc
aaggaggagacgcatctgcagggggagactgacgctgtggctttctgcaccccaagatac
ttcacactcaacatacagacagcatacaccatccccatcatggccttcgccttcgtctgc
caccccgaggtgctgcccatctatacagagctcaaggacccctccaagacgaagatgcag
cgcatctccaacctgtccatcgccgtcatgtatgtcatgtacttcctggccgccctcttc
ggctacctcaccttctacgacggcgtggagtcggagctgctgcacacctacagcaaggtg
gacccgttcgatgtgctgatcctgtgtgtgcgcgtggccgtgctgacggcagtcacgctc
acggtgccaatcgttctgtttccggtgcgccgtgccatccagcagatgatgtttcagagc
cgggagttcagctggctgcggcacgcgctcattgccattagcctgctcactggtatcaac
ctactggtcatcttcgcccccaacatcctgggcatcttcgggatcatcggagccacatcc
gccccgtgcctcattttcatcttccctgccatcttctacttccggatcatgcccactgag
aaggaacctgcaaggtccacccctaaaatcctggccctttgttttgctgtgcttggcttc
ttgctgatgaccatgagcttgagcttcatcatcattgactgggtctcagggaccagccag
catgaaggaagccactag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515039
Entry
107515039         CDS       T06036                                 

Gene name
SLC38A5
Definition
(RefSeq) LOW QUALITY PROTEIN: sodium-coupled neutral amino acid transporter 5
  KO
K14992  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107515039 (SLC38A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107515039 (SLC38A5)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   107515039 (SLC38A5)
SSDB
Motif
Pfam: Aa_trans
Other DBs
NCBI-GeneID: 107515039
NCBI-ProteinID: XP_016008873
LinkDB
Position
Unknown
AA seq 493 aa
MELQDPKMNGAPTAGAVGYRQERESFLPSYNPAPGRKPAQFMDFEGKTSFGMSMFNLSNA
IMGSGILGLAYAMVHTGILFFLALLICIALLSSYSIHLLMTCAGVVGIRAYEQLGQRALG
PVGKVVVAAVICLHNVGAMSSYLFIIKSELPLVIGTFLDMDPEGGWFLKGNLLIIIVSVL
IILPLVLMRHLGYLGYTRGLSLTCMLFFLPQVVYEKFQLGCAVDCNETAVESKSPPAPAG
LPIQGLNRSCEAEMFTVDSQMFYTVPIMAFAFVCHPEVLPIYTELRWPSKRRIQTVANVS
IGAMFCMYELTATFGYLTFYSSVEVEMLHMYSXQDWLILCVRLAVLLVVTLTVSVILFPM
RRALQQLLFPSKAFSWPWHVAIALILLFLINVLVICMPTIRDIFGVIGFTSAPSLNFILP
SVFYLRTVPSKVELLSSWPKIQALCFSVLGVLFMATSLGFMFANWAIGQSHVSEYGPCLA
LAGPLCACACGGR
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggaactacaggatccaaagatgaatggagcccccactgcgggagctgtgggctatagg
caggaacgtgagagcttcctgcctagctataatccagctcctgggaggaagccggcccag
ttcatggattttgaggggaagacatcatttggaatgtcaatgttcaacctcagcaatgcc
atcatgggcagcggcatcctggggctggcctatgccatggtccacacagggatcctcttc
ttcttggcactgctgatatgcattgctcttctgtcttcatactccatccatctcctgatg
acctgtgctggtgttgtaggcatccgagcctatgagcagctgggacagagggcactgggg
cctgtggggaaggtagtggtggctgcagtcatctgtctgcacaatgttggggccatgtcc
agttacctgttcatcatcaaatctgaactccccctggttattggcaccttcctggacatg
gaccctgaggggggctggttcttgaaaggaaacctcctcatcattattgtcagtgtgtta
atcatcctgccactggtcctcatgagacacttgggctacctgggatataccaggggtctc
tctcttacctgcatgctgttcttcctaccccaggtcgtctatgagaagttccagcttggc
tgtgctgtggactgcaatgagacagcagtggagagcaagagccccccggctcccgcaggc
cttcccatccaggggctcaacagaagctgtgaggctgagatgttcacagttgactcacag
atgttctacacagtgcccattatggcttttgcctttgtctgccaccctgaggtgctgccc
atctacacggagctccgctggccttccaagcgtagaatacagactgtggccaatgtgtcc
attggtgccatgttctgcatgtatgagctcacagccacgtttggataccttaccttctac
agcagtgtggaggtggagatgctgcacatgtacagctagcaagactggctcattctctgt
gtgcgcctggcagtgctgctcgtggtgactctcactgtgtcagtcatactgttccctatg
cgccgggccctgcagcagttgctcttcccaagcaaggccttcagctggccatggcatgtg
gctatagccctgatcctgcttttcttgatcaatgtccttgtcatctgcatgccaaccatc
cgggatatttttggagttatcgggtttacctcagcccccagcctcaatttcatccttcct
agtgtcttctacctccgcactgtaccctccaaggtggagctcctctcctcctggcccaag
atccaggctctgtgttttagtgtcctgggggtcctcttcatggcaaccagtctaggcttt
atgtttgccaactgggctataggccagagccatgtgtctgaatacggaccatgccttgct
ctagccggacccctgtgtgcctgtgcatgtggaggaagatga

DBGET integrated database retrieval system