KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513376
Entry
107513376         CDS       T06036                                 

Gene name
GNAI2
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04071  Sphingolipid signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04360  Axon guidance
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04670  Leukocyte transendothelial migration
ray04713  Circadian entrainment
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04924  Renin secretion
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04971  Gastric acid secretion
ray05012  Parkinson disease
ray05030  Cocaine addiction
ray05032  Morphine addiction
ray05034  Alcoholism
ray05133  Pertussis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05163  Human cytomegalovirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107513376 (GNAI2)
   04371 Apelin signaling pathway
    107513376 (GNAI2)
   04071 Sphingolipid signaling pathway
    107513376 (GNAI2)
   04024 cAMP signaling pathway
    107513376 (GNAI2)
   04022 cGMP-PKG signaling pathway
    107513376 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107513376 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107513376 (GNAI2)
   04670 Leukocyte transendothelial migration
    107513376 (GNAI2)
   04062 Chemokine signaling pathway
    107513376 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107513376 (GNAI2)
   04915 Estrogen signaling pathway
    107513376 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    107513376 (GNAI2)
   04921 Oxytocin signaling pathway
    107513376 (GNAI2)
   04926 Relaxin signaling pathway
    107513376 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    107513376 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    107513376 (GNAI2)
   04916 Melanogenesis
    107513376 (GNAI2)
   04924 Renin secretion
    107513376 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107513376 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    107513376 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107513376 (GNAI2)
   04727 GABAergic synapse
    107513376 (GNAI2)
   04725 Cholinergic synapse
    107513376 (GNAI2)
   04728 Dopaminergic synapse
    107513376 (GNAI2)
   04726 Serotonergic synapse
    107513376 (GNAI2)
   04730 Long-term depression
    107513376 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    107513376 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    107513376 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107513376 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513376 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107513376 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    107513376 (GNAI2)
   05032 Morphine addiction
    107513376 (GNAI2)
   05034 Alcoholism
    107513376 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107513376 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107513376 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107513376 (GNAI2)
   05163 Human cytomegalovirus infection
    107513376 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107513376 (GNAI2)
   05142 Chagas disease
    107513376 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107513376 (GNAI2)
   04031 GTP-binding proteins [BR:ray04031]
    107513376 (GNAI2)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107513376 (GNAI2)
GTP-binding proteins [BR:ray04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    107513376 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29
Other DBs
NCBI-GeneID: 107513376
NCBI-ProteinID: XP_016005484
LinkDB
Position
Unknown
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PEDLSGVIRRLWADHGVQTCFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcggccgagcgctccaagatgatcgac
aagaacctgcgggaagacggagagaaggcggcgcgggaggtgaagttgctgctgttgggt
gccggggagtcagggaagagcaccattgtcaagcagatgaagatcatccatgaggatggc
tactcagaggaggaatgccggcagtaccgggcggtcgtctacagcaacaccatccagtcc
atcatggccatcgtcaaagccatgggcaatctgcagattgactttgccgacccctcccgc
gcggatgacgccaggcagctgtttgcgctgtcttgcacggccgaggaacagggcgtgctc
cccgaggacctgtccggcgtcatccggaggctctgggccgaccacggtgtgcagacctgc
tttggccgctcgcgggagtaccagctcaacgactcggccgcctactacctgaatgacctg
gagcgcatcgcacagagtgactacatccccacacagcaggacgtgctacggacccgtgtg
aagaccacgggcatcgtggagacacatttcaccttcaaggacctacacttcaagatgttc
gatgtgggtgggcagcggtctgagcggaagaagtggatccactgctttgagggcgtcaca
gccatcatcttctgcgtagccttgagcgcctatgacctggtgctagccgaggatgaggag
atgaatcgcatgcacgagagcatgaagctgttcgacagcatctgcaacaacaagtggttc
acggacacgtccatcatcctcttcctcaacaagaaggacctgttcgaggagaagatcacg
cacagtcccctgaccatctgcttccctgagtacacaggggccaacaagtacgacgaggcc
gccagctacatccagagcaagttcgaggacctgaacaagcgcaaggacaccaaggagatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagttcgtgttcgacgccgtc
accgacgtcatcatcaagaacaacctgaaggactgcggcctcttctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516134
Entry
107516134         CDS       T06036                                 

Gene name
GNAI3
Definition
(RefSeq) guanine nucleotide-binding protein G(k) subunit alpha
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04071  Sphingolipid signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04360  Axon guidance
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04670  Leukocyte transendothelial migration
ray04713  Circadian entrainment
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04924  Renin secretion
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04971  Gastric acid secretion
ray05012  Parkinson disease
ray05030  Cocaine addiction
ray05032  Morphine addiction
ray05034  Alcoholism
ray05133  Pertussis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05163  Human cytomegalovirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107516134 (GNAI3)
   04371 Apelin signaling pathway
    107516134 (GNAI3)
   04071 Sphingolipid signaling pathway
    107516134 (GNAI3)
   04024 cAMP signaling pathway
    107516134 (GNAI3)
   04022 cGMP-PKG signaling pathway
    107516134 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107516134 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107516134 (GNAI3)
   04670 Leukocyte transendothelial migration
    107516134 (GNAI3)
   04062 Chemokine signaling pathway
    107516134 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107516134 (GNAI3)
   04915 Estrogen signaling pathway
    107516134 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    107516134 (GNAI3)
   04921 Oxytocin signaling pathway
    107516134 (GNAI3)
   04926 Relaxin signaling pathway
    107516134 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    107516134 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    107516134 (GNAI3)
   04916 Melanogenesis
    107516134 (GNAI3)
   04924 Renin secretion
    107516134 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107516134 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    107516134 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107516134 (GNAI3)
   04727 GABAergic synapse
    107516134 (GNAI3)
   04725 Cholinergic synapse
    107516134 (GNAI3)
   04728 Dopaminergic synapse
    107516134 (GNAI3)
   04726 Serotonergic synapse
    107516134 (GNAI3)
   04730 Long-term depression
    107516134 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    107516134 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    107516134 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107516134 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107516134 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107516134 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    107516134 (GNAI3)
   05032 Morphine addiction
    107516134 (GNAI3)
   05034 Alcoholism
    107516134 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107516134 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107516134 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107516134 (GNAI3)
   05163 Human cytomegalovirus infection
    107516134 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107516134 (GNAI3)
   05142 Chagas disease
    107516134 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107516134 (GNAI3)
   04031 GTP-binding proteins [BR:ray04031]
    107516134 (GNAI3)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107516134 (GNAI3)
GTP-binding proteins [BR:ray04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    107516134 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 107516134
NCBI-ProteinID: XP_016011074
LinkDB
Position
Unknown
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFCRSREYQLNDSASYYLNDLDRISQTSYIPTQQDVLRTRVK
TTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaagacaaggcggcggtggagcggagcaagatgatcgac
cgcaacttgcgggaggacggagagaaagcggccaaagaagtgaagctgctgctactcggt
gctggagaatctggtaaaagcaccatcgtgaaacagatgaaaatcattcatgaggatggc
tattcagaggatgaatgtaaacaatataaagtagttgtctacagcaatactatacagtcc
attattgcaatcataagagccatgggacggctaaagattgactttggggaagctgccaga
gcagatgatgcccggcagttgtttgttttagctggcagtgctgaagaaggagtcatgact
ccggaactagcaggagtgattaaacgattatggcgagatggtggggtgcaggcttgcttc
tgcagatccagagaatatcagctcaatgattctgcttcatattacctaaatgatttggat
agaatatcccaaaccagctacattccaactcagcaagatgtcctgcgaacaagagtgaag
accacaggcattgtggaaacacatttcaccttcaaagagctgtacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcattgttttgagggagtgacagca
attatcttctgtgtggccctcagtgattatgaccttgttctggctgaggatgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaacaacaaatggtttaca
gacacttcaatcattctgttcctcaataagaaagacctttttgaggaaaaaataaagagg
agtccattaactatctgttacccagaatacacaggttccaatacatatgaagaagcagct
gcttacattcagtgccagtttgaagatctgaacagaagaaaagataccaaggagatctac
acccacttcacctgtgccacagacaccaagaatgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactctattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518173
Entry
107518173         CDS       T06036                                 

Gene name
GNAI1
Definition
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04071  Sphingolipid signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04360  Axon guidance
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04670  Leukocyte transendothelial migration
ray04713  Circadian entrainment
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04924  Renin secretion
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04971  Gastric acid secretion
ray05012  Parkinson disease
ray05030  Cocaine addiction
ray05032  Morphine addiction
ray05034  Alcoholism
ray05133  Pertussis
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05163  Human cytomegalovirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107518173 (GNAI1)
   04371 Apelin signaling pathway
    107518173 (GNAI1)
   04071 Sphingolipid signaling pathway
    107518173 (GNAI1)
   04024 cAMP signaling pathway
    107518173 (GNAI1)
   04022 cGMP-PKG signaling pathway
    107518173 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107518173 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107518173 (GNAI1)
   04670 Leukocyte transendothelial migration
    107518173 (GNAI1)
   04062 Chemokine signaling pathway
    107518173 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107518173 (GNAI1)
   04915 Estrogen signaling pathway
    107518173 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    107518173 (GNAI1)
   04921 Oxytocin signaling pathway
    107518173 (GNAI1)
   04926 Relaxin signaling pathway
    107518173 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    107518173 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    107518173 (GNAI1)
   04916 Melanogenesis
    107518173 (GNAI1)
   04924 Renin secretion
    107518173 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107518173 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    107518173 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107518173 (GNAI1)
   04727 GABAergic synapse
    107518173 (GNAI1)
   04725 Cholinergic synapse
    107518173 (GNAI1)
   04728 Dopaminergic synapse
    107518173 (GNAI1)
   04726 Serotonergic synapse
    107518173 (GNAI1)
   04730 Long-term depression
    107518173 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    107518173 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    107518173 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107518173 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518173 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107518173 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    107518173 (GNAI1)
   05032 Morphine addiction
    107518173 (GNAI1)
   05034 Alcoholism
    107518173 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107518173 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    107518173 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107518173 (GNAI1)
   05163 Human cytomegalovirus infection
    107518173 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107518173 (GNAI1)
   05142 Chagas disease
    107518173 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107518173 (GNAI1)
   04031 GTP-binding proteins [BR:ray04031]
    107518173 (GNAI1)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107518173 (GNAI1)
GTP-binding proteins [BR:ray04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    107518173 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 107518173
NCBI-ProteinID: XP_016015105
LinkDB
Position
Unknown
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgtacgctgagcgccgaggacaaggcggcggtggagcggagtaagatgatcgac
cggaacctccgcgaggatggcgagaaggcggcgcgtgaggtcaagctgctgctgctgggt
gctggtgaatcggggaaaagtacaattgtgaagcaaatgaaaattattcacgaagctggt
tattcagaagaggaatgtaaacagtacaaagcagtggtctacagtaacaccattcagtca
attattgctatcataagggccatggggagattgaagatagactttggtgactcagctcga
gcggatgatgcccgccaactctttgtgcttgctggagctgctgaagaaggttttatgact
gcagaacttgctggagttataaagagattgtggaaagatagtggtgtgcaagcctgtttc
aacagatcccgagagtaccagcttaatgattctgcagcgtactatttgaatgatttggac
agaatagcacaaccaaattacatcccaactcaacaagatgttctcagaactagagtgaaa
actacaggaattgttgaaacccattttactttcaaagatcttcactttaaaatgtttgac
gtgggaggacagagatctgagcggaagaaatggatccattgcttcgaaggagtgaccgcc
atcattttctgtgtggcgctgagtgactatgacctagttctagccgaagatgaagaaatg
aatcgaatgcacgaaagcatgaagttgtttgacagcatatgtaacaacaaatggtttaca
gatacatctattatactttttctaaacaagaaggatctcttcgaagagaaaatcaaaaag
agccccctcactatatgctatccagaatatgcaggctcaaacacatatgaagaggcagct
gcatatattcagtgtcagtttgaagacctcaataaacgaaaagacacaaaggaaatatac
acccacttcacatgtgccacagatactaagaatgtgcagtttgtttttgatgctgtaaca
gatgtcatcataaaaaataatctaaaagattgtggtcttttctaa

DBGET integrated database retrieval system