KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513391
Entry
107513391         CDS       T06036                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04390  Hippo signaling pathway
ray04392  Hippo signaling pathway - multiple species
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05219  Bladder cancer
ray05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107513391 (RASSF1)
   04390 Hippo signaling pathway
    107513391 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    107513391 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513391 (RASSF1)
   05206 MicroRNAs in cancer
    107513391 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    107513391 (RASSF1)
   05223 Non-small cell lung cancer
    107513391 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH
Other DBs
NCBI-GeneID: 107513391
NCBI-ProteinID: XP_016005505
LinkDB
Position
Unknown
AA seq 332 aa
MRPELEHAGYISVLTVAALTRVLAHAHTGKCARARASGAVVGDYRRTELRRLAGGRARAA
MGEADAGTPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLVRRPRRDQDEPVEWDTP
DLSQAEIEQKVKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPTLQDA
RRSPARGPAVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERA
ERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRIL
QREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 999 nt   +upstreamnt  +downstreamnt
atgagaccagagctagagcatgctggctacatttcagtgctaacggttgcagcgctgaca
cgggttttggcgcacgcgcacactggcaagtgcgcacgcgcacgcgcgtccggggcggtg
gttggagactaccggcgcaccgagctccggcggctggctggcgggcgagcgcgcgcggcg
atgggtgaggcagacgcggggacgccctctttcgagatgacctggagcagcacgacaagc
agtggctactgcagccaggaggactcggactcggagctcgagcagtactttacggcgcgt
acttcgctagtgcgccggccgcgcagggaccaggacgaacctgtggagtgggacacacct
gacctttctcaggctgagattgagcagaaggtcaaggagtacaatggccaaatcaacagc
aacctcttcatgagcctgaacaaagacggctcctacacaggcttcattaaggttcagctg
aagttggtgcgccctgtctcggtgccctccagcaagaagccacccacgttgcaggatgcc
cgacggagcccagcgcggggtccagctgtgaggcgccgcacctccttctacctgcccaag
gatgctgtcaagcaccttcatgtgttgtcacgcacacgggcaagagaggtcatcgaggcc
ctgctgcgcaagttcttggtggtggatgacccccgcaagtttgcactttttgagcgggct
gagcgccatggccaagtgtacctccggaagctgtcggatgatgagcagcccctgcggcta
cggctccttgcaggacccagtgagaaagccctaagctttgtcctgaaagagaatgactct
ggggaggtgaattgggatgccttcagcatgcctgaactacacaacttcctgcgcatcctg
cagcgggaggaagaggaacacctccggcagatcctgcagaagtactcctattgccgccag
aagattcaggaggccctgcacgcctgccccctggggtga

DBGET integrated database retrieval system