KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513418
Entry
107513418         CDS       T06036                                 

Gene name
AGTR1
Definition
(RefSeq) type-1 angiotensin II receptor
  KO
K04166  angiotensin II receptor type 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04072  Phospholipase D signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04614  Renin-angiotensin system
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04927  Cortisol synthesis and secretion
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04934  Cushing syndrome
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107513418 (AGTR1)
   04020 Calcium signaling pathway
    107513418 (AGTR1)
   04072 Phospholipase D signaling pathway
    107513418 (AGTR1)
   04022 cGMP-PKG signaling pathway
    107513418 (AGTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107513418 (AGTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107513418 (AGTR1)
   04614 Renin-angiotensin system
    107513418 (AGTR1)
   04925 Aldosterone synthesis and secretion
    107513418 (AGTR1)
   04927 Cortisol synthesis and secretion
    107513418 (AGTR1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107513418 (AGTR1)
   04270 Vascular smooth muscle contraction
    107513418 (AGTR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513418 (AGTR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107513418 (AGTR1)
   04934 Cushing syndrome
    107513418 (AGTR1)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107513418 (AGTR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107513418 (AGTR1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107513418 (AGTR1)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107513418 (AGTR1)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Peptide
   Angiotensin
    107513418 (AGTR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107513418
NCBI-ProteinID: XP_016005573
LinkDB
Position
Unknown
AA seq 359 aa
MILNSSTDDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASIFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVYFIENTNITVC
AFHYEFQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKTLKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSDNGSLSIKKPALYVEVE
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgatcctcaactcttccactgacgatggtattaaaagaatccaagatgactgtcccaaa
gctggaaggcacaattacatatttgtcatgattcctaccttatacagtatcatttttgtg
gtaggaatatttggaaacagcttggtggtgattgtcatttacttttacatgaaactgaag
actgtggccagtatttttcttttgaatttagcgctggctgatttatgctttttgctgact
ttgccactgtgggctgtctacactgctatggaataccgctggccctttggcaattaccta
tgtaagatcgcttcagccagcgtcagtttcaacctctatgccagtgtgtttctactcact
tgtctaagcattgatcgctatctagctatcgttcacccaatgaagtctcgccttcggcga
acaatgcttgtagccaaagtcacctgcatcattatttggctactggctggcttggcgagt
ttgccaactataatccatcgaaatgtatatttcatcgaaaacaccaatatcacagtttgt
gctttccattatgaattccaaaattcaaccctccccataggtctgggcctaaccaagaat
atactgggtttcttgtttccttttctcattattcttacaagttatactcttatttggaag
accctgaagaaggcttatgaaattcagaagaacaagcctagaaatgatgatattttcaag
ataatcatggcaattgtgcttttctttttcttttcctgggttccccaccaaatattcact
ttcttggatgtattgattcagctgggcatcatacatgactgtaaaattgcagatattgtt
gataccgccatgcccatcactatttgcatagcttattttaataattgtctgaatcctctt
ttttatggcttccttgggaaaaaatttaaaaaatattttcttcagcttctgaaatacatc
cctccaaaggccaaatctcactcaagcctatcaacaaaaatgagcacactttcctaccgc
ccctcagataatggaagcttatccatcaaaaagcctgccctgtatgttgaggttgagtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517857
Entry
107517857         CDS       T06036                                 

Gene name
AGTR2
Definition
(RefSeq) type-2 angiotensin II receptor
  KO
K04167  angiotensin II receptor type 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04261  Adrenergic signaling in cardiomyocytes
ray04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107517857 (AGTR2)
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    107517857 (AGTR2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107517857 (AGTR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107517857 (AGTR2)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Peptide
   Angiotensin
    107517857 (AGTR2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 107517857
NCBI-ProteinID: XP_016014497
LinkDB
Position
Unknown
AA seq 359 aa
MTGNFAFAAISKNVTSSLHFGLVNISGNESTFNCAHKPSDKHLDAIPILYYIIFVIGFLV
NTIVVTLFCCQKGPKKVSSIYIFNLAVADLLLLVSLPLWATYYSYRYEWLFGSVLCKVFG
SFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLIWCMACLSSLPTFYF
RDVRTVDYLGVNACIMAFPPEKYAQWSAGIALMRNILGFIIPLIFIATCYFGIRKHLLKA
NSYGKTRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLTLPFAI
LLGFTNSCINPFLYCFVGNRFQQKLRGVFRVPITWLQGKRESVSCRKSSSLREMETFVS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgacaggcaacttcgcctttgccgccatcagcaaaaacgtcaccagcagtcttcatttt
ggacttgtgaatatctctggcaatgagtctacttttaactgtgcacataagccatcagat
aagcatttagatgcaattcctattctctactacattatttttgtgattggatttctcgtc
aatactattgtggtcacactgttttgttgtcaaaagggccctaaaaaggtttccagcatt
tacattttcaacctggctgtggctgacttactgcttttggtttctcttcctctctgggca
acctattattcttacagatatgaatggctctttggatctgtactgtgcaaagtttttggt
tctttcctgaccctgaacatgtttgcaagcattttttttatcacctgcatgagcgttgat
aggtaccaatctgtcatctatccctttttgtctcaaagaagaaatccctggcaggcatct
tatatagttccccttatttggtgtatggcttgtctgtcttcattgccaacattttatttt
cgagatgtcagaaccgttgactacttaggagtgaatgcttgcattatggctttcccgcct
gagaaatatgctcaatggtcagctgggattgccttaatgagaaatatacttggttttatt
attcctttaatattcatagcaacatgctatttcggaatcagaaaacacttactaaaggcc
aatagctatgggaagactcgtgaccaagtcctgaagatggcagctgctgttgttttggcg
ttcatcatttgttggcttcccttccatgttctgactttcctggatgctctggcctggatg
ggtgtcattaatagctgtgaagttatagcagtcattgacctgacacttccttttgccatc
ctcctgggattcaccaacagctgcattaatccctttttgtattgttttgttggaaaccgg
ttccaacagaagctccgcggtgtgtttagggttccaattacttggctccaaggcaagaga
gagagtgtgtcatgccgaaaaagcagttcccttagagaaatggagacttttgtgtcttaa

DBGET integrated database retrieval system