KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513651
Entry
107513651         CDS       T06036                                 

Gene name
TNNT2
Definition
(RefSeq) troponin T, cardiac muscle isoform X1
  KO
K12045  troponin T, cardiac muscle
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107513651 (TNNT2)
   04261 Adrenergic signaling in cardiomyocytes
    107513651 (TNNT2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107513651 (TNNT2)
   05414 Dilated cardiomyopathy
    107513651 (TNNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107513651 (TNNT2)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     107513651 (TNNT2)
SSDB
Motif
Pfam: Troponin
Other DBs
NCBI-GeneID: 107513651
NCBI-ProteinID: XP_016006071
LinkDB
Position
Unknown
AA seq 293 aa
MSDVEEVAEEYEGEQEEETVEEQEEAAEDEAGDEVEAEEPTADGEAEGEEGGPEEEAEEA
DDGPVEESKPKPRPFMPNLVPPKIPGGERVDFDDIHRKRMEKDLNELQTLIEAHFESRKK
EEEELISLKDRIEKRRAERAEQQRIRSEREKERQARLAEERARREEEESRRRAEDEARKK
KALSNMMHFGGYIQKQAQTERRSGKRQTEREKKKKILSERRKVLAIDHLNEDQLREKAKE
LWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
NT seq 882 nt   +upstreamnt  +downstreamnt
atgtctgacgtggaagaggtggccgaggagtacgagggggagcaggaagaggaaaccgtg
gaagagcaggaggaggcagcagaggatgaggctggcgacgaggtggaggccgaggagccg
accgcagatggcgaggctgagggcgaggaaggcgggccagaagaggaagccgaggaggct
gacgacggcccagtggaggagtctaaaccgaagcccaggccgttcatgcccaacctggtg
ccccccaagatccccggcggcgagagagtggacttcgacgacatccaccgcaagcgcatg
gagaaggacctgaacgagctgcagacgctgatcgaggctcacttcgagagcaggaagaag
gaggaggaggagctcatttccctcaaagacaggatcgagaagcggcgggcggagcgggcg
gagcagcagcgcattcggagtgagcgggagaaggagcggcaggcgcgcctggcggaggag
agggccaggcgggaggaggaggagagccggcggagggcagaggacgaggcccgcaagaag
aaggcgctgtccaacatgatgcacttcggaggctacatccagaagcaggcgcagacggag
cggagaagcgggaagaggcagacagagcgggaaaagaagaagaagattctgtccgagaga
aggaaggtgctggccatcgaccacctgaacgaagaccagctgagggagaaggccaaggag
ctctggcagagcatctacaacctggaggcagagaagttcgacctgcaggagaagttcaag
cagcagaaatacgaaatcaatgtgctccgaaacaggatcaacgacaaccagaaagtctcc
aagacccgcgggaaggccaaagtcaccgggcgctggaagtag

DBGET integrated database retrieval system