KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513731
Entry
107513731         CDS       T06036                                 

Gene name
DCT
Definition
(RefSeq) L-dopachrome tautomerase
  KO
K01827  dopachrome tautomerase [EC:5.3.3.12]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00350  Tyrosine metabolism
ray01100  Metabolic pathways
ray04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107513731 (DCT)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107513731 (DCT)
Enzymes [BR:ray01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.12  L-dopachrome isomerase
     107513731 (DCT)
SSDB
Motif
Pfam: Tyrosinase PetG
Other DBs
NCBI-GeneID: 107513731
NCBI-ProteinID: XP_016006227
LinkDB
Position
Unknown
AA seq 517 aa
MGPLLWGLLLSCLGCGILPGVWAQFPRVCMTVDNLVSKECCPPLGAEPDNVCGSRAGRGQ
CTEVQTDTRPWGGPYVLRNQDDRERWPRKFFNRTCKCTGNFAGYNCGGCKFGWIGLNCDR
KKPPVVRQNIHSLTPQEREQFLGALDLAKKTIHPDYVITTQHWLGLLGPNGTQPQIANCS
IYDFFVWLHYYSVRDTLLGPGRPYKAIDFSHQGPAFVTWHRYHLLWLERDLQRLIGNESF
ALPYWNFATGRNECDVCTDQLFGAARQDDPTLISQNSRFSSWEIVCDSLDDYNRRVTLCN
GTYEGLLRRNRVGRNSEKLPNLKDIQDCLSLTKFDNPPFFQNSTFSFRNALEGFDKADGT
LDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHCFTDAIFDEWMKRFNPSVDAWPQE
LAPIGHNRMYNMVPFFPPVTNEEFFLTADQLGYSYVIDLPVEETPSWNTTLSVVMGMLVA
LIGLLVLLAFLQYRRLRKGYAPLMETHLSNKRYTEEA
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgggcccccttctgtgggggcttctgctcagttgcctgggctgtggaatcctgcctggg
gtttgggcgcagttccctcgggtctgcatgaccgtggacaacctcgtgtctaaggagtgc
tgcccgccgcttggtgcggagccggacaacgtctgtggctctcgggcgggccggggccag
tgcacggaggtgcagacagacaccaggccctggggtggtccctacgtcctgcggaaccag
gatgaccgagaacggtggccacggaagttcttcaatcggacctgcaagtgcacaggaaac
tttgctggctacaactgcggaggctgcaagtttggctggattggcctcaactgcgatcgg
aagaaaccaccagttgttcgacagaacatccattccttgactcctcaggagagggagcaa
ttcttgggtgccttagacctcgcaaagaagaccatacaccccgactacgtgatcactaca
caacactggctgggcctgcttgggcccaatgggacccagccacagattgccaactgcagc
atttatgatttctttgtgtggctccattactattctgttagagatacattattaggacca
gggcgcccatacaaggccatagatttctcacaccaaggacctgcctttgtcacctggcac
cggtaccatttgttgtggctggaaagagatctccagcgacttattggcaatgagtccttc
gctttgccttactggaactttgctactgggaggaatgagtgtgacgtgtgtacagaccaa
ctgtttggggcagcgaggcaagacgatccgactctgattagtcagaactcaagattctcc
agctgggaaatcgtctgtgatagcttagatgactacaaccgccgggtcaccctgtgtaat
ggaacctatgaaggtttgttgagaagaaatcgagtgggaagaaacagtgagaaactgcca
aacttaaaagatatacaagattgtctgtctctcacgaagtttgacaatcctccttttttc
cagaactctaccttcagcttcaggaatgccctggaagggtttgataaagcagacgggacc
ttggactctcaagtgatgagccttcataatttggttcattccttcctgaacgggacaaat
gctttgccacattctgccgccaatgatcccatttttgtggtccttcattgttttactgat
gccatttttgatgagtggatgaaaagatttaacccttctgtggatgcctggcctcaggag
ctggcacccattggtcacaacaggatgtataacatggttcctttctttcctccggtgact
aacgaggaattctttttaaccgcagaccaacttggctacagctacgttattgacctgcca
gttgaagaaactccaagttggaatacaaccctctcagtagttatgggaatgctggtggct
ttgattggtctcttggtgctgttggctttccttcagtatagaagacttcgaaaaggatat
gcacccctaatggagacacatttaagcaataagaggtacacggaagaagcctaa

DBGET integrated database retrieval system